Uracil-DNA glycosylase inhibitor
Details
- Name
- Uracil-DNA glycosylase inhibitor
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- UGI
- UniProtKB Entry
- P14739Swiss-Prot
- Organism
- Bacillus phage PBS2
- NCBI Taxonomy ID
- 10684
- Amino acid sequence
>lcl|BSEQ0012146|Uracil-DNA glycosylase inhibitor MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTS DAPEYKPWALVIQDSNGENKIKML
- Number of residues
- 84
- Molecular Weight
- 9475.645
- Theoretical pI
- 3.87
- GO Classification
- Not Available
- General Function
- This protein binds specifically and reversibly to the host uracil-DNA glycosylase, preventing removal of uracil residues from PBS2 DNA by the host uracil-excision repair system.
- Specific Function
- Not Available
- Pfam Domain Function
- Not Available
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0005983|255 bp ATGACAAATTTATCTGACATCATTGAAAAAGAAACAGGAAAACAACTAGTGATTCAAGAA TCAATTCTAATGTTACCAGAAGAAGTAGAGGAAGTAATTGGGAATAAACCAGAAAGTGAT ATTTTAGTTCATACTGCTTATGATGAAAGTACAGATGAAAATGTAATGCTATTAACTTCA GATGCTCCAGAATATAAACCTTGGGCTTTAGTAATTCAAGACAGTAATGGAGAAAATAAA ATTAAAATGTTATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P14739 UniProtKB Entry Name UNGI_BPPB2 GenBank Gene ID J04434 PDB ID(s) 1EUI, 1LQG, 1LQM, 1UDI, 1UGH, 1UGI, 1UUG, 2J8X, 2UGI, 2UUG, 2ZHX, 4LYL - General References
- Wang Z, Mosbaugh DW: Uracil-DNA glycosylase inhibitor gene of bacteriophage PBS2 encodes a binding protein specific for uracil-DNA glycosylase. J Biol Chem. 1989 Jan 15;264(2):1163-71. [Article]
- Lundquist AJ, Beger RD, Bennett SE, Bolton PH, Mosbaugh DW: Site-directed mutagenesis and characterization of uracil-DNA glycosylase inhibitor protein. Role of specific carboxylic amino acids in complex formation with Escherichia coli uracil-DNA glycosylase. J Biol Chem. 1997 Aug 22;272(34):21408-19. [Article]
- Ravishankar R, Bidya Sagar M, Roy S, Purnapatre K, Handa P, Varshney U, Vijayan M: X-ray analysis of a complex of Escherichia coli uracil DNA glycosylase (EcUDG) with a proteinaceous inhibitor. The structure elucidation of a prokaryotic UDG. Nucleic Acids Res. 1998 Nov 1;26(21):4880-7. [Article]
- Putnam CD, Shroyer MJ, Lundquist AJ, Mol CD, Arvai AS, Mosbaugh DW, Tainer JA: Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase. J Mol Biol. 1999 Mar 26;287(2):331-46. [Article]