Azurin
Details
- Name
- Azurin
- Synonyms
- Azurin precursor
- Gene Name
- azu
- Organism
- Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
- Amino acid sequence
>lcl|BSEQ0021295|Azurin MLRKLAAVSLLSLLSAPLLAAECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLP KNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFCTFPGHSALMKGTLTLK
- Number of residues
- 148
- Molecular Weight
- 16008.315
- Theoretical pI
- 6.93
- GO Classification
- Functionscopper ion binding / electron carrier activity / transition metal ion binding / zinc ion bindingProcessesoxidation-reduction processComponentsperiplasmic space
- General Function
- Zinc ion binding
- Specific Function
- Transfers electrons from cytochrome c551 to cytochrome oxidase.
- Pfam Domain Function
- Copper-bind (PF00127)
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Gene sequence
>lcl|BSEQ0021296|Azurin (azu) ATGCTACGTAAACTCGCTGCGGTATCCCTGCTGTCCCTGCTCAGTGCGCCACTGCTGGCT GCCGAGTGCTCGGTGGACATCCAGGGTAACGACCAGATGCAGTTCAACACCAATGCCATC ACCGTCGACAAGAGCTGCAAGCAGTTCACCGTCAACCTGTCCCACCCCGGCAACCTGCCG AAGAACGTCATGGGCCACAACTGGGTACTGAGCACCGCCGCCGACATGCAGGGCGTGGTC ACCGACGGCATGGCTTCCGGCCTGGACAAGGATTACCTGAAGCCCGACGACAGCCGTGTC ATCGCCCACACCAAGCTGATCGGCTCGGGCGAGAAGGACTCGGTGACCTTCGACGTCTCC AAGCTGAAGGAAGGCGAGCAGTACATGTTCTTCTGCACCTTCCCGGGCCACTCCGCGCTG ATGAAGGGCACCCTGACCCTGAAGTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00282 UniProtKB Entry Name AZUR_PSEAE GenBank Protein ID 45292 GenBank Gene ID X07317 - General References
- Arvidsson RH, Nordling M, Lundberg LG: The azurin gene from Pseudomonas aeruginosa. Cloning and characterization. Eur J Biochem. 1989 Jan 15;179(1):195-200. [Article]
- Hoitink CW, Woudt LP, Turenhout JC, van de Kamp M, Canters GW: Isolation and sequencing of the Alcaligenes denitrificans azurin-encoding gene: comparison with the genes encoding blue copper proteins from Pseudomonas aeruginosa and Alcaligenes faecalis. Gene. 1990 May 31;90(1):15-20. [Article]
- Canters GW: The azurin gene from Pseudomonas aeruginosa codes for a pre-protein with a signal peptide. Cloning and sequencing of the azurin gene. FEBS Lett. 1987 Feb 9;212(1):168-72. [Article]
- Stover CK, Pham XQ, Erwin AL, Mizoguchi SD, Warrener P, Hickey MJ, Brinkman FS, Hufnagle WO, Kowalik DJ, Lagrou M, Garber RL, Goltry L, Tolentino E, Westbrock-Wadman S, Yuan Y, Brody LL, Coulter SN, Folger KR, Kas A, Larbig K, Lim R, Smith K, Spencer D, Wong GK, Wu Z, Paulsen IT, Reizer J, Saier MH, Hancock RE, Lory S, Olson MV: Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen. Nature. 2000 Aug 31;406(6799):959-64. [Article]
- Adman ET, Stenkamp RE, Sieker LC, Jensen LH: A crystallographic model for azurin a 3 A resolution. J Mol Biol. 1978 Jul 25;123(1):35-47. [Article]
- Nar H, Messerschmidt A, Huber R, van de Kamp M, Canters GW: Crystal structure of Pseudomonas aeruginosa apo-azurin at 1.85 A resolution. FEBS Lett. 1992 Jul 20;306(2-3):119-24. [Article]
- Hammann C, Messerschmidt A, Huber R, Nar H, Gilardi G, Canters GW: X-ray crystal structure of the two site-specific mutants Ile7Ser and Phe110Ser of azurin from Pseudomonas aeruginosa. J Mol Biol. 1996 Jan 26;255(3):362-6. [Article]
- Hammann C, van Pouderoyen G, Nar H, Gomis Ruth FX, Messerschmidt A, Huber R, den Blaauwen T, Canters GW: Crystal structures of modified apo-His117Gly and apo-His46Gly mutants of Pseudomonas aeruginosa azurin. J Mol Biol. 1997 Feb 21;266(2):357-66. [Article]
- Karlsson BG, Tsai LC, Nar H, Sanders-Loehr J, Bonander N, Langer V, Sjolin L: X-ray structure determination and characterization of the Pseudomonas aeruginosa azurin mutant Met121Glu. Biochemistry. 1997 Apr 8;36(14):4089-95. [Article]
- van de Kamp M, Canters GW, Wijmenga SS, Lommen A, Hilbers CW, Nar H, Messerschmidt A, Huber R: Complete sequential 1H and 15N nuclear magnetic resonance assignments and solution secondary structure of the blue copper protein azurin from Pseudomonas aeruginosa. Biochemistry. 1992 Oct 27;31(42):10194-207. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01915 S-Hydroxycysteine experimental unknown Details DB02586 4,7-Dimethyl-[1,10]Phenanthroline experimental unknown Details DB03492 lambda-bis(2,2'-bipyridine)imidazole osmium (II) experimental unknown Details DB03570 Tris-Hydroxymethyl-Methyl-Ammonium experimental unknown Details DB03840 Tetra(Imidazole)Diaquacopper (Ii) experimental unknown Details DB03871 lambda-bis(2,2'-bipyridine)imidazole ruthenium (II) experimental unknown Details DB04085 Bis(N-maleimidomethyl)ether experimental unknown Details DB04100 Tricarbonyl(1,10-phenanthroline)rhenium(1+) experimental unknown Details DB04231 Tetra(imidazole)diaquacopper (I) experimental unknown Details DB06968 1,1'-HEXANE-1,6-DIYLBIS(1H-IMIDAZOLE) experimental unknown Details