Steroid Delta-isomerase
Details
- Name
- Steroid Delta-isomerase
- Synonyms
- 5.3.3.1
- Delta(5)-3-ketosteroid isomerase
- Gene Name
- ksi
- Organism
- Comamonas testosteroni
- Amino acid sequence
>lcl|BSEQ0011140|Steroid Delta-isomerase MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLK LPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKN IHAGA
- Number of residues
- 125
- Molecular Weight
- 13398.04
- Theoretical pI
- 5.13
- GO Classification
- Functionssteroid delta-isomerase activityProcessessteroid metabolic process
- General Function
- Steroid delta-isomerase activity
- Specific Function
- Not Available
- Pfam Domain Function
- SnoaL_2 (PF12680)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0003188|378 bp ATGAATACCCCAGAACATATGACCGCCGTGGTACAGCGCTATGTGGCTGCGCTCAATGCC GGCGATCTGGACGGCATCGTCGCGCTGTTTGCCGATGACGCCACGGTGGAAGACCCCGTG GGTTCCGAGCCCAGGTCCGGTACGGCTGCGATTCGTGAGTTTTACGCCAACTCGCTCAAA CTGCCTTTGGCGGTGGAGCTGACGCAGGAGGTACGCGCGGTCGCCAACGAAGCGGCCTTC GCTTTCACCGTCAGCTTCGAGTATCAGGGCCGCAAGACCGTGGTTGCGCCCATCGATCAC TTTCGCTTCAATGGCGCCGGCAAGGTGGTGAGCATGCGCGCCTTGTTTGGCGAGAAGAAT ATTCACGCTGGCGCCTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00947 UniProtKB Entry Name SDIS_COMTE GenBank Protein ID 151322 GenBank Gene ID M22749 - General References
- Choi KY, Benisek WF: Nucleotide sequence of the gene for the delta 5-3-ketosteroid isomerase of Pseudomonas testosteroni. Gene. 1988 Sep 15;69(1):121-9. [Article]
- Kuliopulos A, Shortle D, Talalay P: Isolation and sequencing of the gene encoding delta 5-3-ketosteroid isomerase of Pseudomonas testosteroni: overexpression of the protein. Proc Natl Acad Sci U S A. 1987 Dec;84(24):8893-7. [Article]
- Benson AM, Jarabak R, Talalay P: The amino acid sequence of 5 -3-ketosteroid isomerase of Pseudomonas testosteroni. J Biol Chem. 1971 Dec 25;246(24):7514-25. [Article]
- Weintraub H, Vincent F, Baulieu EE, Alfsen A: Molecular weight determination and structural studies of Pseudomonas testosteroni delta 5 leads to 4-3-oxosteroid isomerase (EC 5.3.3.1). FEBS Lett. 1973 Nov 15;37(1):82-8. [Article]
- Kim SW, Cha SS, Cho HS, Kim JS, Ha NC, Cho MJ, Joo S, Kim KK, Choi KY, Oh BH: High-resolution crystal structures of delta5-3-ketosteroid isomerase with and without a reaction intermediate analogue. Biochemistry. 1997 Nov 18;36(46):14030-6. [Article]
- Wu ZR, Ebrahimian S, Zawrotny ME, Thornburg LD, Perez-Alvarado GC, Brothers P, Pollack RM, Summers MF: Solution structure of 3-oxo-delta5-steroid isomerase. Science. 1997 Apr 18;276(5311):415-8. [Article]
- Massiah MA, Abeygunawardana C, Gittis AG, Mildvan AS: Solution structure of Delta 5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone hemisuccinate. Biochemistry. 1998 Oct 20;37(42):14701-12. [Article]
- Cho HS, Ha NC, Choi G, Kim HJ, Lee D, Oh KS, Kim KS, Lee W, Choi KY, Oh BH: Crystal structure of delta(5)-3-ketosteroid isomerase from Pseudomonas testosteroni in complex with equilenin settles the correct hydrogen bonding scheme for transition state stabilization. J Biol Chem. 1999 Nov 12;274(46):32863-8. [Article]
- Nam GH, Cha SS, Yun YS, Oh YH, Hong BH, Lee HS, Choi KY: The conserved cis-Pro39 residue plays a crucial role in the proper positioning of the catalytic base Asp38 in ketosteroid isomerase from Comamonas testosteroni. Biochem J. 2003 Oct 15;375(Pt 2):297-305. [Article]
- Yun YS, Lee TH, Nam GH, Jang DS, Shin S, Oh BH, Choi KY: Origin of the different pH activity profile in two homologous ketosteroid isomerases. J Biol Chem. 2003 Jul 25;278(30):28229-36. Epub 2003 May 6. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB03515 Equilenin experimental unknown Details DB04693 Estrane-3,17-dione experimental unknown Details DB08308 SUCCINIC ACID MONO-(13-METHYL-3-OXO-2,3,6,7,8,9,10,11,12,13,14,15,16,17-TETRADECAHYDRO-1H-CYCLOPENTA[A]PHENANTHREN-17-YL) ESTER experimental unknown Details DB01561 Androstanedione experimental, illicit unknown Details