Oxytocin-neurophysin 1
Details
- Name
- Oxytocin-neurophysin 1
- Synonyms
- OT
- OT-NPI
- Gene Name
- OXT
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0010529|Oxytocin-neurophysin 1 MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA EELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEA TFSQR
- Number of residues
- 125
- Molecular Weight
- 12721.51
- Theoretical pI
- 5.78
- GO Classification
- Processesdrinking behavior / eating behavior / female pregnancy / grooming behavior / heart development / hyperosmotic salinity response / male mating behavior / maternal aggressive behavior / maternal behavior / memory / negative regulation of blood pressure / negative regulation of gastric acid secretion / negative regulation of urine volume / positive regulation of blood pressure / positive regulation of cytosolic calcium ion concentration / positive regulation of female receptivity / positive regulation of hindgut contraction / positive regulation of norepinephrine secretion / positive regulation of ossification / positive regulation of penile erection / positive regulation of prostaglandin secretion / positive regulation of renal sodium excretion / positive regulation of synapse assembly / positive regulation of synaptic transmission / positive regulation of uterine smooth muscle contraction / regulation of heart rate / regulation of sensory perception of pain / response to activity / response to amphetamine / response to cAMP / response to cocaine / response to electrical stimulus / response to estradiol / response to ether / response to glucocorticoid / response to peptide hormone / response to progesterone / response to prostaglandin E / response to retinoic acid / response to sucrose / signal transduction / sleep / social behavior / sperm ejaculationComponentscytosol / extracellular region / extracellular space / secretory granule / terminal bouton
- General Function
- Not Available
- Specific Function
- Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0010530|Oxytocin-neurophysin 1 (OXT) ATGGCCGGCCCCAGCCTCGCTTGCTGTCTGCTCGGCCTCCTGGCGCTGACCTCCGCCTGC TACATCCAGAACTGCCCCCTGGGAGGCAAGAGGGCCGCGCCGGACCTCGACGTGCGCAAG TGCCTCCCCTGCGGCCCCGGGGGCAAAGGCCGCTGCTTCGGGCCCAATATCTGCTGCGCG GAAGAGCTGGGCTGCTTCGTGGGCACCGCCGAAGCGCTGCGCTGCCAGGAGGAGAACTAC CTGCCGTCGCCCTGCCAGTCCGGCCAGAAGGCGTGCGGGAGCGGGGGCCGCTGCGCGGTC TTGGGCCTCTGCTGCAGCCCGGACGGCTGCCACGCCGACCCTGCCTGCGACGCGGAAGCC ACCTTCTCCCAGCGCTGA
- Chromosome Location
- 20
- Locus
- 20p13
- External Identifiers
Resource Link UniProtKB ID P01178 UniProtKB Entry Name NEU1_HUMAN GenBank Protein ID 189411 GenBank Gene ID M25650 GenAtlas ID OXT HGNC ID HGNC:8528 - General References
- Rehbein M, Hillers M, Mohr E, Ivell R, Morley S, Schmale H, Richter D: The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation. Biol Chem Hoppe Seyler. 1986 Aug;367(8):695-704. [Article]
- Sausville E, Carney D, Battey J: The human vasopressin gene is linked to the oxytocin gene and is selectively expressed in a cultured lung cancer cell line. J Biol Chem. 1985 Aug 25;260(18):10236-41. [Article]
- Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Ivell R, Furuya K, Brackmann B, Dawood Y, Khan-Dawood F: Expression of the oxytocin and vasopressin genes in human and baboon gonadal tissues. Endocrinology. 1990 Dec;127(6):2990-6. [Article]
- Mohr E, Hillers M, Ivell R, Haulica ID, Richter D: Expression of the vasopressin and oxytocin genes in human hypothalami. FEBS Lett. 1985 Nov 25;193(1):12-6. [Article]
- Chauvet MT, Hurpet D, Chauvet J, Acher R: Identification of human neurophysins: complete amino acid sequences of MSEL- and VLDV-neurophysins. Proc Natl Acad Sci U S A. 1983 May;80(10):2839-43. [Article]
- Schlesinger DH, Audhya TK: A comparative study of mammalian neurophysin protein sequences. FEBS Lett. 1981 Jun 15;128(2):325-8. [Article]
- LIGHT A, DU VIGNEAUD V: On the nature of oxytocin and vasopressin from human pituitary. Proc Soc Exp Biol Med. 1958 Aug-Sep;98(4):692-6. [Article]