Myoglobin
Details
- Name
- Myoglobin
- Synonyms
- Not Available
- Gene Name
- MB
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0013125|Myoglobin MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
- Number of residues
- 154
- Molecular Weight
- 17183.725
- Theoretical pI
- Not Available
- GO Classification
- Functionsheme binding / metal ion binding / oxygen binding / oxygen transporter activityProcessesbrown fat cell differentiation / enucleate erythrocyte differentiation / heart development / response to hormone / response to hydrogen peroxide / response to hypoxia / slow-twitch skeletal muscle fiber contractionComponentsextracellular exosome
- General Function
- Oxygen transporter activity
- Specific Function
- Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
- Pfam Domain Function
- Globin (PF00042)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0013126|Myoglobin (MB) ATGGGGCTCAGCGACGGGGAATGGCAGTTGGTGCTGAACGTCTGGGGGAAGGTGGAGGCT GACATCCCAGGCCATGGGCAGGAAGTCCTCATCAGGCTCTTTAAGGGTCACCCAGAGACT CTGGAGAAGTTTGACAAGTTCAAGCACCTGAAGTCAGAGGACGAGATGAAGGCGTCTGAG GACTTAAAGAAGCATGGTGCCACCGTGCTCACCGCCCTGGGTGGCATCCTTAAGAAGAAG GGGCATCATGAGGCAGAGATTAAGCCCCTGGCACAGTCGCATGCCACCAAGCACAAGATC CCCGTGAAGTACCTGGAGTTCATCTCGGAATGCATCATCCAGGTTCTGCAGAGCAAGCAT CCCGGGGACTTTGGTGCTGATGCCCAGGGGGCCATGAACAAGGCCCTGGAGCTGTTCCGG AAGGACATGGCCTCCAACTACAAGGAGCTGGGCTTCCAGGGCTAG
- Chromosome Location
- 22
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P02144 UniProtKB Entry Name MYG_HUMAN HGNC ID HGNC:6915 - General References
- Weller P, Jeffreys AJ, Wilson V, Blanchetot A: Organization of the human myoglobin gene. EMBO J. 1984 Feb;3(2):439-46. [Article]
- Akaboshi E: Cloning of the human myoglobin gene. Gene. 1985;33(3):241-9. [Article]
- Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [Article]
- Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Herrera AE, Lehmann H: Primary structure of human myoglobin. Nat New Biol. 1971 Aug 4;232(31):149-52. [Article]
- Romero Herrera AE, Lehmann H: The myoglobin of primates. I. Hylobates agilis (gibbon). Biochim Biophys Acta. 1971 Dec 28;251(3):482-8. [Article]
- Romero Herrera AE, Lehmann H: The myoglobin of primates. II. Pan Troglodytes (chimpanzee). Biochim Biophys Acta. 1972 Aug 31;278(1):62-7. [Article]
- Corbett JM, Wheeler CH, Baker CS, Yacoub MH, Dunn MJ: The human myocardial two-dimensional gel protein database: update 1994. Electrophoresis. 1994 Nov;15(11):1459-65. [Article]
- Boulton FE, Huntsman RG, Lorkin PA, Lehmann H: Abnormal human myoglobin: 53 (D4) glutamic acid--lysine. Nature. 1969 Aug 23;223(5208):832-3. [Article]
- Boulton FE, Huntsman RG, Romero Herrera A, Lorkin PA, Lehmann H: The third variant of human myoglobin showing an unusual amino acid substitution: 138(H16)arginine--tryptophan. Biochim Biophys Acta. 1971 Mar 23;229(3):716-9. [Article]
- Boulton FE, Huntsman RG, Romero Herrera AE, Lorkin PA, Lehmann H: A human myoglobin variant 133 (H-10)lysine--asparagine. Biochim Biophys Acta. 1971 Mar 23;229(3):871-6. [Article]
- Boulton FE, Huntsman RG, Yawson GI, Romero Herrera AE, Lorkin PA, Lehmann H: The second variant of human myoglobin; 138(H16) arginine leads to glutamine. Br J Haematol. 1971 Jan;20(1):69-74. [Article]
- Hubbard SR, Hendrickson WA, Lambright DG, Boxer SG: X-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution. J Mol Biol. 1990 May 20;213(2):215-8. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01710 Porphyrin Fe(III) experimental unknown Details DB01826 N-Butyl Isocyanide experimental unknown Details DB02073 Biliverdine IX Alpha experimental unknown Details DB02396 Methylethylamine experimental unknown Details DB02528 Tetrazolyl Histidine experimental unknown Details DB02671 1-Methylimidazole experimental unknown Details DB03366 Imidazole experimental, investigational unknown Details DB03385 4-Methylimidazole experimental unknown Details DB03399 Ethyl Isocyanide experimental unknown Details DB04050 N-Propyl Isocyanide experimental unknown Details DB02379 Beta-D-Glucose experimental unknown Details DB04337 Isocyanomethane experimental unknown Details DB02646 Nitrosoethane experimental unknown Details DB09112 Nitrous acid approved, investigational unknown oxidizer Details DB11588 Carbon monoxide approved, investigational yes inhibitor Details