C-X-C motif chemokine 10
Details
- Name
- C-X-C motif chemokine 10
- Synonyms
- 10 kDa interferon gamma-induced protein
- Gamma-IP10
- INP10
- IP-10
- SCYB10
- Small-inducible cytokine B10
- Gene Name
- CXCL10
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0016256|C-X-C motif chemokine 10 MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Number of residues
- 98
- Molecular Weight
- 10880.915
- Theoretical pI
- 10.62
- GO Classification
- FunctionscAMP-dependent protein kinase regulator activity / chemokine activity / CXCR3 chemokine receptor binding / heparin binding / receptor bindingProcessesblood circulation / cell surface receptor signaling pathway / cell-cell signaling / cellular response to heat / cellular response to lipopolysaccharide / chemokine-mediated signaling pathway / chemotaxis / defense response to virus / endothelial cell activation / G-protein coupled receptor signaling pathway / immune response / inflammatory response / muscle organ development / negative regulation of angiogenesis / negative regulation of myoblast differentiation / negative regulation of myoblast fusion / positive regulation of cAMP metabolic process / positive regulation of cAMP-mediated signaling / positive regulation of cell proliferation / positive regulation of leukocyte chemotaxis / positive regulation of monocyte chemotaxis / positive regulation of release of sequestered calcium ion into cytosol / positive regulation of T cell migration / positive regulation of transcription from RNA polymerase II promoter / regulation of cell proliferation / regulation of endothelial tube morphogenesis / regulation of protein kinase activity / regulation of T cell chemotaxis / response to auditory stimulus / response to cold / response to gamma radiation / response to vitamin D / signal transduction / T cell chemotaxisComponentsexternal side of plasma membrane / extracellular region / extracellular space
- General Function
- Receptor binding
- Specific Function
- Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
- Pfam Domain Function
- IL8 (PF00048)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0016257|C-X-C motif chemokine 10 (CXCL10) ATGAATCAAACTGCCATTCTGATTTGCTGCCTTATCTTTCTGACTCTAAGTGGCATTCAA GGAGTACCTCTCTCTAGAACTGTACGCTGTACCTGCATCAGCATTAGTAATCAACCTGTT AATCCAAGGTCTTTAGAAAAACTTGAAATTATTCCTGCAAGCCAATTTTGTCCACGTGTT GAGATCATTGCTACAATGAAAAAGAAGGGTGAGAAGAGATGTCTGAATCCAGAATCGAAG GCCATCAAGAATTTACTGAAAGCAGTTAGCAAGGAAAGGTCTAAAAGATCTCCTTAA
- Chromosome Location
- 4
- Locus
- 4q21
- External Identifiers
Resource Link UniProtKB ID P02778 UniProtKB Entry Name CXL10_HUMAN GenBank Protein ID 33918 GenBank Gene ID X02530 GenAtlas ID CXCL10 HGNC ID HGNC:10637 - General References
- Luster AD, Unkeless JC, Ravetch JV: Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins. Nature. 1985 Jun 20-26;315(6021):672-6. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Proost P, De Wolf-Peeters C, Conings R, Opdenakker G, Billiau A, Van Damme J: Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8. J Immunol. 1993 Feb 1;150(3):1000-10. [Article]
- Tensen CP, Flier J, Van Der Raaij-Helmer EM, Sampat-Sardjoepersad S, Van Der Schors RC, Leurs R, Scheper RJ, Boorsma DM, Willemze R: Human IP-9: A keratinocyte-derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3). J Invest Dermatol. 1999 May;112(5):716-22. [Article]
- Hensbergen PJ, van der Raaij-Helmer EM, Dijkman R, van der Schors RC, Werner-Felmayer G, Boorsma DM, Scheper RJ, Willemze R, Tensen CP: Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity. Eur J Biochem. 2001 Sep;268(18):4992-9. [Article]
- Loos T, Mortier A, Gouwy M, Ronsse I, Put W, Lenaerts JP, Van Damme J, Proost P: Citrullination of CXCL10 and CXCL11 by peptidylarginine deiminase: a naturally occurring posttranslational modification of chemokines and new dimension of immunoregulation. Blood. 2008 Oct 1;112(7):2648-56. doi: 10.1182/blood-2008-04-149039. Epub 2008 Jul 21. [Article]
- Booth V, Keizer DW, Kamphuis MB, Clark-Lewis I, Sykes BD: The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions. Biochemistry. 2002 Aug 20;41(33):10418-25. [Article]