Steroid Delta-isomerase
Details
- Name
- Steroid Delta-isomerase
- Synonyms
- 5.3.3.1
- Delta(5)-3-ketosteroid isomerase
- Gene Name
- ksi
- Organism
- Pseudomonas putida
- Amino acid sequence
>lcl|BSEQ0010861|Steroid Delta-isomerase MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQG LGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYW SEVNLSVREPQ
- Number of residues
- 131
- Molecular Weight
- 14535.48
- Theoretical pI
- 4.53
- GO Classification
- Functionssteroid delta-isomerase activityProcessessteroid metabolic process
- General Function
- Steroid delta-isomerase activity
- Specific Function
- Not Available
- Pfam Domain Function
- SnoaL_2 (PF12680)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0002460|396 bp ATGAACCTACCGACTGCGCAGGAAGTCCAGGGCCTGATGGCCCGTTACATCGAGCTGGTC GATGTCGGGGATATCGAGGCGATCGTGCAGATGTACGCCGATGACGCCACGGTCGAAGAC CCGTTTGGCCAGCCGCCGATCCACGGCCGCGAGCAGATTGCCGCGTTCTATCGCCAGGGT TTGGGCGGGGGCAAGGTCCGCGCCTGCCTGACCGGGCCGGTACGGGCCAGCCATAACGGC TGCGGGGCGATGCCGTTTCGCGTCGAGATGGTCTGGAACGGCCAGCCCTGTGCACTGGAT GTCATCGATGTGATGCGCTTTGATGAGCACGGCCGGATCCAGACGATGCAAGCCTACTGG AGCGAGGTCAACCTCAGCGTGCGCGAGCCGCAGTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P07445 UniProtKB Entry Name SDIS_PSEPU GenBank Protein ID 309871 GenBank Gene ID L13127 - General References
- Kim SW, Kim CY, Benisek WF, Choi KY: Cloning, nucleotide sequence, and overexpression of the gene coding for delta 5-3-ketosteroid isomerase from Pseudomonas putida biotype B. J Bacteriol. 1994 Nov;176(21):6672-6. [Article]
- Linden KG, Benisek WF: The amino acid sequence of a delta 5-3-oxosteroid isomerase from Pseudomonas putida biotype B. J Biol Chem. 1986 May 15;261(14):6454-60. [Article]
- Kim SW, Cha SS, Cho HS, Kim JS, Ha NC, Cho MJ, Joo S, Kim KK, Choi KY, Oh BH: High-resolution crystal structures of delta5-3-ketosteroid isomerase with and without a reaction intermediate analogue. Biochemistry. 1997 Nov 18;36(46):14030-6. [Article]
- Kim DH, Nam GH, Jang DS, Choi G, Joo S, Kim JS, Oh BH, Choi KY: Roles of active site aromatic residues in catalysis by ketosteroid isomerase from Pseudomonas putida biotype B. Biochemistry. 1999 Oct 19;38(42):13810-9. [Article]
- Choi G, Ha NC, Kim SW, Kim DH, Park S, Oh BH, Choi KY: Asp-99 donates a hydrogen bond not to Tyr-14 but to the steroid directly in the catalytic mechanism of Delta 5-3-ketosteroid isomerase from Pseudomonas putida biotype B. Biochemistry. 2000 Feb 8;39(5):903-9. [Article]
- Ha NC, Kim MS, Lee W, Choi KY, Oh BH: Detection of large pKa perturbations of an inhibitor and a catalytic group at an enzyme active site, a mechanistic basis for catalytic power of many enzymes. J Biol Chem. 2000 Dec 29;275(52):41100-6. [Article]
- Nam GH, Jang DS, Cha SS, Lee TH, Kim DH, Hong BH, Yun YS, Oh BH, Choi KY: Maintenance of alpha-helical structures by phenyl rings in the active-site tyrosine triad contributes to catalysis and stability of ketosteroid isomerase from Pseudomonas putida biotype B. Biochemistry. 2001 Nov 13;40(45):13529-37. [Article]
- Yun YS, Nam GH, Kim YG, Oh BH, Choi KY: Small exterior hydrophobic cluster contributes to conformational stability and steroid binding in ketosteroid isomerase from Pseudomonas putida biotype B. FEBS J. 2005 Apr;272(8):1999-2011. [Article]