Trypsin-2
Details
- Name
- Trypsin-2
- Synonyms
- 3.4.21.4
- Anionic trypsinogen
- Serine protease 2
- TRY2
- TRYP2
- Trypsin II
- Gene Name
- PRSS2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0017464|Trypsin-2 MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK DTIAANS
- Number of residues
- 247
- Molecular Weight
- 26487.55
- Theoretical pI
- Not Available
- GO Classification
- Functionscalcium ion binding / serine-type endopeptidase activityProcessescollagen catabolic process / digestion / extracellular matrix disassembly / extracellular matrix organization / innate immune response / positive regulation of cell adhesion / positive regulation of cell growth / proteolysisComponentsextracellular matrix / extracellular region / extracellular space
- General Function
- Serine-type endopeptidase activity
- Specific Function
- In the ileum, may be involved in defensin processing, including DEFA5.
- Pfam Domain Function
- Trypsin (PF00089)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P07478 UniProtKB Entry Name TRY2_HUMAN HGNC ID HGNC:9483 - General References
- Emi M, Nakamura Y, Ogawa M, Yamamoto T, Nishide T, Mori T, Matsubara K: Cloning, characterization and nucleotide sequences of two cDNAs encoding human pancreatic trypsinogens. Gene. 1986;41(2-3):305-10. [Article]
- Kimland M, Russick C, Marks WH, Borgstrom A: Immunoreactive anionic and cationic trypsin in human serum. Clin Chim Acta. 1989 Sep 15;184(1):31-46. [Article]
- Ghosh D, Porter E, Shen B, Lee SK, Wilk D, Drazba J, Yadav SP, Crabb JW, Ganz T, Bevins CL: Paneth cell trypsin is the processing enzyme for human defensin-5. Nat Immunol. 2002 Jun;3(6):583-90. Epub 2002 May 20. [Article]
- Sahin-Toth M, Kukor Z, Nemoda Z: Human cationic trypsinogen is sulfated on Tyr154. FEBS J. 2006 Nov;273(22):5044-50. [Article]
- Szabo A, Salameh MA, Ludwig M, Radisky ES, Sahin-Toth M: Tyrosine sulfation of human trypsin steers S2' subsite selectivity towards basic amino acids. PLoS One. 2014 Jul 10;9(7):e102063. doi: 10.1371/journal.pone.0102063. eCollection 2014. [Article]
- Ronai Z, Witt H, Rickards O, Destro-Bisol G, Bradbury AR, Sahin-Toth M: A common African polymorphism abolishes tyrosine sulfation of human anionic trypsinogen (PRSS2). Biochem J. 2009 Feb 15;418(1):155-61. doi: 10.1042/BJ20081848. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01805 Monoisopropylphosphorylserine experimental unknown Details DB01973 O-Benzylsulfonyl-Serine experimental unknown Details DB03976 Phosphorylisopropane experimental unknown Details DB02464 Benzylamine experimental unknown Details DB03127 Benzamidine experimental unknown Details DB04325 Phenethylamine experimental unknown Details DB04410 3-Phenylpropylamine experimental unknown Details