Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
Details
- Name
- Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
- Synonyms
- 2.1.1.57
- PAP-S
- Poly(A) polymerase regulatory subunit
- Poly(A) polymerase small subunit
- VP39
- Gene Name
- PAPS
- Organism
- VACV
- Amino acid sequence
>lcl|BSEQ0019110|Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILD GATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEY LRSIKKQLHPSKIILISDVRSKRGGNEPSTADLLSNYALQNVMISILNPVASSLKWRCPF PDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLN KIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIPTTS TEKVSHEPIQRKISSKNSMSKNRNSKRSVRSNK
- Number of residues
- 333
- Molecular Weight
- 38887.65
- Theoretical pI
- 9.94
- GO Classification
- FunctionsmRNA (nucleoside-2'-O-)-methyltransferase activity / translation elongation factor activityProcesses7-methylguanosine mRNA capping / regulation of mRNA 3'-end processing / transcription, DNA-templatedComponentsvirion
- General Function
- Translation elongation factor activity
- Specific Function
- Displays methyltransferase, positive regulation of the poly(A) polymerase and transcription elongation activities. Involved in the modification of both mRNA ends and in intermediate and late gene positive transcription elongation. At the mRNAs 5' end, methylates the ribose 2' OH group of the first transcribed nucleotide, thereby producing a 2'-O-methylpurine cap. At the 3' end, functions as a processivity factor which stimulates the activity of the viral poly(A) polymerase VP55 that creates mRNA's poly(A) tail. In the presence of VP39, VP55 does not dissociate from the RNA allowing tail elongation to around 250 adenylates.
- Pfam Domain Function
- PARP_regulatory (PF01358)
- Transmembrane Regions
- Not Available
- Cellular Location
- Virion
- Gene sequence
>lcl|BSEQ0019111|Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase (PAPS) ATGGATGTTGTGTCGTTAGATAAACCGTTTATGTATTTTGAGGAAATTGATAATGAGTTA GATTACGAACCAGAAAGTGCAAATGAGGTCGCAAAAAAACTGCCGTATCAAGGACAGTTA AAACTATTACTAGGAGAATTATTTTTTCTTAGTAAGTTACAGCGACACGGTATATTAGAT GGTGCCACCGTAGTGTATATAGGATCTGCTCCCGGTACACATATACGTTATTTGAGAGAT CATTTCTATAATTTAGGAGTGATCATCAAATGGATGCTAATTGACGGCCGCCATCATGAT CCTATTTTAAATGGATTGCGTGATGTGACTCTAGTGACTCGGTTCGTTGATGAGGAATAT CTACGATCCATCAAAAAACAACTGCATCCTTCTAAGATTATTTTAATTTCTGATGTGAGA TCCAAACGAGGAGGAAATGAACCTAGTACGGCGGATTTACTAAGTAATTACGCTCTACAA AATGTCATGATTAGTATTTTAAACCCCGTGGCGTCTAGTCTTAAATGGAGATGCCCGTTT CCAGATCAATGGATCAAGGACTTTTATATCCCACACGGTAATAAAATGTTACAACCTTTT GCTCCTTCATATTCAGCTGAAATGAGATTATTAAGTATTTATACCGGTGAGAACATGAGA CTGACTCGAGTTACCAAATCAGACGCTGTAAATTATGAAAAAAAGATGTACTACCTTAAT AAGATCGTCCGTAACAAAGTAGTTGTTAACTTTGATTATCCTAATCAGGAATATGACTAT TTTCACATGTACTTTATGCTGAGGACCGTGTACTGCAATAAAACATTTCCTACTACTAAA GCAAAGGTACTATTTCTACAACAATCTATATTTCGTTTCTTAAATATTCCAACAACATCA ACTGAAAAAGTTAGTCATGAACCAATACAACGTAAAATATCTAGCAAAAATTCTATGTCT AAAAACAGAAATAGCAAGAGATCCGTACGCAGTAATAAATAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P07617 UniProtKB Entry Name MCE_VACCW GenBank Protein ID 61396 GenBank Gene ID X01978 - General References
- Plucienniczak A, Schroeder E, Zettlmeissl G, Streeck RE: Nucleotide sequence of a cluster of early and late genes in a conserved segment of the vaccinia virus genome. Nucleic Acids Res. 1985 Feb 11;13(3):985-98. [Article]
- Schnierle BS, Gershon PD, Moss B: Cap-specific mRNA (nucleoside-O2'-)-methyltransferase and poly(A) polymerase stimulatory activities of vaccinia virus are mediated by a single protein. Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):2897-901. [Article]
- Gershon PD, Ahn BY, Garfield M, Moss B: Poly(A) polymerase and a dissociable polyadenylation stimulatory factor encoded by vaccinia virus. Cell. 1991 Sep 20;66(6):1269-78. [Article]
- Mohamed MR, Latner DR, Condit RC, Niles EG: Interaction between the J3R subunit of vaccinia virus poly(A) polymerase and the H4L subunit of the viral RNA polymerase. Virology. 2001 Feb 1;280(1):143-52. [Article]
- Oguro A, Johnson L, Gershon PD: Path of an RNA ligand around the surface of the vaccinia VP39 subunit of its cognate VP39-VP55 protein heterodimer. Chem Biol. 2002 Jun;9(6):679-90. [Article]
- Latner DR, Thompson JM, Gershon PD, Storrs C, Condit RC: The positive transcription elongation factor activity of the vaccinia virus J3 protein is independent from its (nucleoside-2'-O-) methyltransferase and poly(A) polymerase stimulatory functions. Virology. 2002 Sep 15;301(1):64-80. [Article]
- Li C, Xia Y, Gao X, Gershon PD: Mechanism of RNA 2'-O-methylation: evidence that the catalytic lysine acts to steer rather than deprotonate the target nucleophile. Biochemistry. 2004 May 18;43(19):5680-7. [Article]
- Hodel AE, Gershon PD, Shi X, Quiocho FA: The 1.85 A structure of vaccinia protein VP39: a bifunctional enzyme that participates in the modification of both mRNA ends. Cell. 1996 Apr 19;85(2):247-56. [Article]
- Hodel AE, Gershon PD, Shi X, Wang SM, Quiocho FA: Specific protein recognition of an mRNA cap through its alkylated base. Nat Struct Biol. 1997 May;4(5):350-4. [Article]
- Hodel AE, Gershon PD, Quiocho FA: Structural basis for sequence-nonspecific recognition of 5'-capped mRNA by a cap-modifying enzyme. Mol Cell. 1998 Feb;1(3):443-7. [Article]
- Hu G, Gershon PD, Hodel AE, Quiocho FA: mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains. Proc Natl Acad Sci U S A. 1999 Jun 22;96(13):7149-54. [Article]
- Hu G, Oguro A, Li C, Gershon PD, Quiocho FA: The "cap-binding slot" of an mRNA cap-binding protein: quantitative effects of aromatic side chain choice in the double-stacking sandwich with cap. Biochemistry. 2002 Jun 18;41(24):7677-87. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01752 S-adenosyl-L-homocysteine experimental unknown Details DB01960 7-methyl-7,8-dihydroguanosine-5'-diphosphate experimental unknown Details DB01978 7,9-Dimethylguanine experimental unknown Details DB03164 6-amino-1-methyl-7H-purin-1-ium experimental unknown Details DB03358 7-Methyl-7,8-dihydroguanosine 5'-(tetrahydrogen triphosphate) experimental unknown Details DB03493 7-Methylguanosine experimental unknown Details DB04103 3-Methylcytosine experimental unknown Details DB04314 1-Methylcytosine experimental unknown Details