Ribonuclease pancreatic
Details
- Name
- Ribonuclease pancreatic
- Synonyms
- 3.1.27.5
- HP-RNase
- RIB-1
- RIB1
- Ribonuclease 1
- Ribonuclease A
- RNase 1
- RNase A
- RNase UpI-1
- RNS1
- Gene Name
- RNASE1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0012319|Ribonuclease pancreatic MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
- Number of residues
- 156
- Molecular Weight
- 17644.125
- Theoretical pI
- 8.94
- GO Classification
- Functionsnucleic acid binding / ribonuclease A activityProcessesRNA phosphodiester bond hydrolysis, endonucleolyticComponentsextracellular exosome
- General Function
- Ribonuclease a activity
- Specific Function
- Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single-stranded and double-stranded RNA.
- Pfam Domain Function
- RnaseA (PF00074)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0012320|Ribonuclease pancreatic (RNASE1) ATGGCTCTGGAGAAGTCTCTTGTCCGGCTCCTTCTGCTTGTCCTGATACTGCTGGTGCTG GGCTGGGTCCAGCCTTCCCTGGGCAAGGAATCCCGGGCCAAGAAATTCCAGCGGCAGCAT ATGGACTCAGACAGTTCCCCCAGCAGCAGCTCCACCTACTGTAACCAAATGATGAGGCGC CGGAATATGACACAGGGGCGGTGCAAACCAGTGAACACCTTTGTGCACGAGCCCCTGGTA GATGTCCAGAATGTCTGTTTCCAGGAAAAGGTCACCTGCAAGAACGGGCAGGGCAACTGC TACAAGAGCAACTCCAGCATGCACATCACAGACTGCCGCCTGACAAACGGCTCCAGGTAC CCCAACTGTGCATACCGGACCAGCCCGAAGGAGAGACACATCATTGTGGCCTGTGAAGGG AGCCCATATGTGCCAGTCCACTTTGATGCTTCTGTGGAGGACTCTACCTAA
- Chromosome Location
- 14
- Locus
- 14q11.2
- External Identifiers
Resource Link UniProtKB ID P07998 UniProtKB Entry Name RNAS1_HUMAN GenBank Gene ID D26129 GenAtlas ID RNASE1 HGNC ID HGNC:10044 - General References
- Seno M, Futami J, Kosaka M, Seno S, Yamada H: Nucleotide sequence encoding human pancreatic ribonuclease. Biochim Biophys Acta. 1994 Aug 2;1218(3):466-8. [Article]
- Schienman JE, Holt RA, Auerbach MR, Stewart CB: Duplication and divergence of 2 distinct pancreatic ribonuclease genes in leaf-eating African and Asian colobine monkeys. Mol Biol Evol. 2006 Aug;23(8):1465-79. Epub 2006 Jun 2. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Kochetov AV, Lukasheva VV, Filipenko ML, Mertvetsov NP, Rivkin MI: [Primary structure of the coding part of the gene for human pancreatic ribonuclease and its chromosomal location]. Bioorg Khim. 1995 Sep;21(9):691-4. [Article]
- Russo N, de Nigris M, Ciardiello A, Di Donato A, D'Alessio G: Expression in mammalian cells, purification and characterization of recombinant human pancreatic ribonuclease. FEBS Lett. 1995 Aug 7;369(2-3):352. [Article]
- Haugg M, Schein CH: The DNA sequences of the human and hamster secretory ribonucleases determined with the polymerase chain reaction (PCR). Nucleic Acids Res. 1992 Feb 11;20(3):612. [Article]
- Beintema JJ, Wietzes P, Weickmann JL, Glitz DG: The amino acid sequence of human pancreatic ribonuclease. Anal Biochem. 1984 Jan;136(1):48-64. [Article]
- Beintema JJ, Blank A, Schieven GL, Dekker CA, Sorrentino S, Libonati M: Differences in glycosylation pattern of human secretory ribonucleases. Biochem J. 1988 Oct 15;255(2):501-5. [Article]
- Mizuta K, Awazu S, Yasuda T, Kishi K: Purification and characterization of three ribonucleases from human kidney: comparison with urine ribonucleases. Arch Biochem Biophys. 1990 Aug 15;281(1):144-51. [Article]
- Sakakibara R, Hashida K, Tominaga N, Sakai K, Ishiguro M, Imamura S, Ohmatsu F, Sato E: A putative mouse oocyte maturation inhibitory protein from urine of pregnant women: N-terminal sequence homology with human nonsecretory ribonuclease. Chem Pharm Bull (Tokyo). 1991 Jan;39(1):146-9. [Article]
- Sakakibara R, Hashida K, Kitahara T, Ishiguro M: Characterization of a unique nonsecretory ribonuclease from urine of pregnant women. J Biochem. 1992 Mar;111(3):325-30. [Article]
- Yasuda T, Nadano D, Takeshita H, Kishi K: Two distinct secretory ribonucleases from human cerebrum: purification, characterization and relationships to other ribonucleases. Biochem J. 1993 Dec 15;296 ( Pt 3):617-25. [Article]
- Pous J, Canals A, Terzyan SS, Guasch A, Benito A, Ribo M, Vilanova M, Coll M: Three-dimensional structure of a human pancreatic ribonuclease variant, a step forward in the design of cytotoxic ribonucleases. J Mol Biol. 2000 Oct 13;303(1):49-60. [Article]
- Pous J, Mallorqui-Fernandez G, Peracaula R, Terzyan SS, Futami J, Tada H, Yamada H, Seno M, de Llorens R, Gomis-Ruth FX, Coll M: Three-dimensional structure of human RNase 1 delta N7 at 1.9 A resolution. Acta Crystallogr D Biol Crystallogr. 2001 Apr;57(Pt 4):498-505. [Article]
- Canals A, Pous J, Guasch A, Benito A, Ribo M, Vilanova M, Coll M: The structure of an engineered domain-swapped ribonuclease dimer and its implications for the evolution of proteins toward oligomerization. Structure. 2001 Oct;9(10):967-76. [Article]
- Johnson RJ, McCoy JG, Bingman CA, Phillips GN Jr, Raines RT: Inhibition of human pancreatic ribonuclease by the human ribonuclease inhibitor protein. J Mol Biol. 2007 Apr 27;368(2):434-49. Epub 2007 Feb 9. [Article]
- Yamada H, Tamada T, Kosaka M, Miyata K, Fujiki S, Tano M, Moriya M, Yamanishi M, Honjo E, Tada H, Ino T, Yamaguchi H, Futami J, Seno M, Nomoto T, Hirata T, Yoshimura M, Kuroki R: 'Crystal lattice engineering,' an approach to engineer protein crystal contacts by creating intermolecular symmetry: crystallization and structure determination of a mutant human RNase 1 with a hydrophobic interface of leucines. Protein Sci. 2007 Jul;16(7):1389-97. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01812 Adenosine 3',5'-diphosphate experimental unknown Details DB01842 3'-Phosphate-Adenosine-5'-Diphosphate experimental unknown Details DB01942 Formic acid experimental, investigational unknown Details DB01961 Cytidine 3'-monophosphate experimental unknown Details DB02098 Adenosine-2'-5'-Diphosphate experimental unknown Details DB02363 2'-Monophosphoadenosine-5'-Diphosphate experimental unknown Details DB02805 Arabinouridine 3'-phosphate experimental unknown Details DB00536 Guanidine approved unknown Details DB03155 2'-fluoro-2'-deoxyuridine 3'-monophosphate experimental unknown Details DB03186 Adenylate-3'-phosphate-[[2'-deoxy-uridine-5'-phosphate]-3'-phosphate] experimental unknown Details DB03326 Deoxycytidylyl-3',5'-guanosine experimental unknown Details DB03448 2'-Deoxyuridine 3'-Monophosphate experimental unknown Details DB03512 Uridine-2',3'-vanadate experimental unknown Details DB03726 Purine Riboside-5'-Monophosphate experimental unknown Details DB03765 2'-cytidylic acid experimental unknown Details DB03792 5-Aminouracil experimental unknown Details DB03900 tert-butanol experimental unknown Details DB04272 Citric acid approved, nutraceutical, vet_approved unknown Details DB02573 2'-deoxycytidine-2'-deoxyadenosine-3',5'-monophosphate experimental unknown Details DB02714 3'-Uridinemonophosphate experimental unknown Details DB02987 Cysteine-S-acetamide experimental unknown Details DB03447 Uridylyl-2'-5'-phospho-adenosine experimental unknown Details DB04514 Uridylyl-2'-5'-phospho-guanosine experimental unknown Details DB00128 Aspartic acid approved, nutraceutical unknown Details DB04464 N-Formylmethionine experimental unknown Details DB08596 5'-deoxy-5'-piperidin-1-ylthymidine experimental unknown Details DB08661 1-(2,5-dideoxy-5-pyrrolidin-1-yl-beta-L-erythro-pentofuranosyl)-5-methylpyrimidine-2,4(1H,3H)-dione experimental unknown Details