Fibroblast growth factor 2
Details
- Name
- Fibroblast growth factor 2
- Synonyms
- Basic fibroblast growth factor
- bFGF
- FGF-2
- FGFB
- HBGF-2
- Heparin-binding growth factor 2
- Gene Name
- FGF2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0037112|Fibroblast growth factor 2 MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Number of residues
- 288
- Molecular Weight
- 30769.715
- Theoretical pI
- 10.01
- GO Classification
- Functionschemoattractant activity / cytokine activity / fibroblast growth factor receptor binding / growth factor activity / heparin binding / ligand-dependent nuclear receptor transcription coactivator activityProcessesactivation of MAPK activity / activation of MAPKK activity / axon guidance / branching involved in ureteric bud morphogenesis / cell migration involved in sprouting angiogenesis / chemotaxis / chondroblast differentiation / embryonic morphogenesis / epidermal growth factor receptor signaling pathway / extracellular matrix organization / Fc-epsilon receptor signaling pathway / fibroblast growth factor receptor signaling pathway / growth factor dependent regulation of skeletal muscle satellite cell proliferation / hyaluronan catabolic process / innate immune response / inositol phosphate biosynthetic process / insulin receptor signaling pathway / MAPK cascade / negative regulation of blood vessel endothelial cell migration / negative regulation of cell death / negative regulation of fibroblast migration / negative regulation of wound healing / nervous system development / neurotrophin TRK receptor signaling pathway / organ morphogenesis / phosphatidylinositol biosynthetic process / phosphatidylinositol-mediated signaling / positive chemotaxis / positive regulation of angiogenesis / positive regulation of blood vessel endothelial cell migration / positive regulation of cardiac muscle cell proliferation / positive regulation of cell division / positive regulation of cell fate specification / positive regulation of cell proliferation / positive regulation of endothelial cell chemotaxis to fibroblast growth factor / positive regulation of endothelial cell proliferation / positive regulation of ERK1 and ERK2 cascade / positive regulation of MAP kinase activity / positive regulation of phosphatidylinositol 3-kinase activity / positive regulation of phospholipase C activity / positive regulation of sprouting angiogenesis / positive regulation of transcription from RNA polymerase II promoter / positive regulation of transcription, DNA-templated / Ras protein signal transduction / regulation of angiogenesis / regulation of endothelial cell chemotaxis to fibroblast growth factor / release of sequestered calcium ion into cytosol / signal transduction / small GTPase mediated signal transduction / somatic stem cell population maintenance / vascular endothelial growth factor receptor signaling pathway / wound healingComponentsextracellular region / extracellular space / nucleus
- General Function
- Ligand-dependent nuclear receptor transcription coactivator activity
- Specific Function
- Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.
- Pfam Domain Function
- FGF (PF00167)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0021843|Fibroblast growth factor 2 (FGF2) CTGGTGGGTGTGGGGGGTGGAGATGTAGAAGATGTGACGCCGCGGCCCGGCGGGTGCCAG ATTAGCGGACGCGGTGCCCGCGGTTGCAACGGGATCCCGGGCGCTGCAGCTTGGGAGGCG GCTCTCCCCAGGCGGCGTCCGCGGAGACACCCATCCGTGAACCCCAGGTCCCGGGCCGCC GGCTCGCCGCGCACCAGGGGCCGGCGGACAGAAGAGCGGCCGAGCGGCTCGAGGCTGGGG GACCGCGGGCGCGGCCGCGCGCTGCCGGGCGGGAGGCTGGGGGGCCGGGGCCGGGGCCGT GCCCCGGAGCGGGTCGGAGGCCGGGGCCGGGGCCGGGGGACGGCGGCTCCCCGCGCGGCT CCAGCGGCTCGGGGATCCCGGCCGGGCCCCGCAGGGACCATGGCAGCCGGGAGCATCACC ACGCTGCCCGCCTTGCCCGAGGATGGCGGCAGCGGCGCCTTCCCGCCCGGCCACTTCAAG GACCCCAAGCGGCTGTACTGCAAAAACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGC CGAGTTGACGGGGTCCGGGAGAAGAGCGACCCTCACATCAAGCTACAACTTCAAGCAGAA GAGAGAGGAGTTGTGTCTATCAAAGGAGTGTGTGCTAACCGTTACCTGGCTATGAAGGAA GATGGAAGATTACTGGCTTCTAAATGTGTTACGGATGAGTGTTTCTTTTTTGAACGATTG GAATCTAATAACTACAATACTTACCGGTCAAGGAAATACACCAGTTGGTATGTGGCACTG AAACGAACTGGGCAGTATAAACTTGGATCCAAAACAGGACCTGGGCAGAAAGCTATACTT TTTCTTCCAATGTCTGCTAAGAGCTGA
- Chromosome Location
- 4
- Locus
- 4q26-q27
- External Identifiers
Resource Link UniProtKB ID P09038 UniProtKB Entry Name FGF2_HUMAN GenBank Protein ID 31362 GenBank Gene ID X04431 GenAtlas ID FGF2 HGNC ID HGNC:3676 - General References
- Abraham JA, Whang JL, Tumolo A, Mergia A, Fiddes JC: Human basic fibroblast growth factor: nucleotide sequence, genomic organization, and expression in mammalian cells. Cold Spring Harb Symp Quant Biol. 1986;51 Pt 1:657-68. [Article]
- Abraham JA, Whang JL, Tumolo A, Mergia A, Friedman J, Gospodarowicz D, Fiddes JC: Human basic fibroblast growth factor: nucleotide sequence and genomic organization. EMBO J. 1986 Oct;5(10):2523-8. [Article]
- Prats H, Kaghad M, Prats AC, Klagsbrun M, Lelias JM, Liauzun P, Chalon P, Tauber JP, Amalric F, Smith JA, et al.: High molecular mass forms of basic fibroblast growth factor are initiated by alternative CUG codons. Proc Natl Acad Sci U S A. 1989 Mar;86(6):1836-40. [Article]
- Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [Article]
- Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [Article]
- Florkiewicz RZ, Shibata F, Barankiewicz T, Baird A, Gonzalez AM, Florkiewicz E, Shah N: Basic fibroblast growth factor gene expression. Ann N Y Acad Sci. 1991;638:109-26. [Article]
- Kurokawa T, Sasada R, Iwane M, Igarashi K: Cloning and expression of cDNA encoding human basic fibroblast growth factor. FEBS Lett. 1987 Mar 9;213(1):189-94. [Article]
- Shimoyama Y, Gotoh M, Ino Y, Sakamoto M, Kato K, Hirohashi S: Characterization of high-molecular-mass forms of basic fibroblast growth factor produced by hepatocellular carcinoma cells: possible involvement of basic fibroblast growth factor in hepatocarcinogenesis. Jpn J Cancer Res. 1991 Nov;82(11):1263-70. [Article]
- Izbicka E, Dunstan C, Esparza J, Jacobs C, Sabatini M, Mundy GR: Human amniotic tumor that induces new bone formation in vivo produces growth-regulatory activity in vitro for osteoblasts identified as an extended form of basic fibroblast growth factor. Cancer Res. 1996 Feb 1;56(3):633-6. [Article]
- Sommer A, Brewer MT, Thompson RC, Moscatelli D, Presta M, Rifkin DB: A form of human basic fibroblast growth factor with an extended amino terminus. Biochem Biophys Res Commun. 1987 Apr 29;144(2):543-50. [Article]
- Story MT, Esch F, Shimasaki S, Sasse J, Jacobs SC, Lawson RK: Amino-terminal sequence of a large form of basic fibroblast growth factor isolated from human benign prostatic hyperplastic tissue. Biochem Biophys Res Commun. 1987 Feb 13;142(3):702-9. [Article]
- Gimenez-Gallego G, Conn G, Hatcher VB, Thomas KA: Human brain-derived acidic and basic fibroblast growth factors: amino terminal sequences and specific mitogenic activities. Biochem Biophys Res Commun. 1986 Mar 13;135(2):541-8. [Article]
- Gautschi P, Frater-Schroder M, Bohlen P: Partial molecular characterization of endothelial cell mitogens from human brain: acidic and basic fibroblast growth factors. FEBS Lett. 1986 Aug 18;204(2):203-7. [Article]
- Watson R, Anthony F, Pickett M, Lambden P, Masson GM, Thomas EJ: Reverse transcription with nested polymerase chain reaction shows expression of basic fibroblast growth factor transcripts in human granulosa and cumulus cells from in vitro fertilisation patients. Biochem Biophys Res Commun. 1992 Sep 30;187(3):1227-31. [Article]
- Wu DQ, Kan MK, Sato GH, Okamoto T, Sato JD: Characterization and molecular cloning of a putative binding protein for heparin-binding growth factors. J Biol Chem. 1991 Sep 5;266(25):16778-85. [Article]
- Ornitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao G, Goldfarb M: Receptor specificity of the fibroblast growth factor family. J Biol Chem. 1996 Jun 21;271(25):15292-7. [Article]
- Goretzki L, Burg MA, Grako KA, Stallcup WB: High-affinity binding of basic fibroblast growth factor and platelet-derived growth factor-AA to the core protein of the NG2 proteoglycan. J Biol Chem. 1999 Jun 11;274(24):16831-7. [Article]
- Tassi E, Al-Attar A, Aigner A, Swift MR, McDonnell K, Karavanov A, Wellstein A: Enhancement of fibroblast growth factor (FGF) activity by an FGF-binding protein. J Biol Chem. 2001 Oct 26;276(43):40247-53. Epub 2001 Aug 16. [Article]
- Skjerpen CS, Wesche J, Olsnes S: Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor. J Biol Chem. 2002 Jun 28;277(26):23864-71. Epub 2002 Apr 18. [Article]
- Xie B, Tassi E, Swift MR, McDonnell K, Bowden ET, Wang S, Ueda Y, Tomita Y, Riegel AT, Wellstein A: Identification of the fibroblast growth factor (FGF)-interacting domain in a secreted FGF-binding protein by phage display. J Biol Chem. 2006 Jan 13;281(2):1137-44. Epub 2005 Oct 27. [Article]
- Zhang W, Chen Y, Swift MR, Tassi E, Stylianou DC, Gibby KA, Riegel AT, Wellstein A: Effect of FGF-binding protein 3 on vascular permeability. J Biol Chem. 2008 Oct 17;283(42):28329-37. doi: 10.1074/jbc.M802144200. Epub 2008 Jul 31. [Article]
- Ebert AD, Laussmann M, Wegehingel S, Kaderali L, Erfle H, Reichert J, Lechner J, Beer HD, Pepperkok R, Nickel W: Tec-kinase-mediated phosphorylation of fibroblast growth factor 2 is essential for unconventional secretion. Traffic. 2010 Jun;11(6):813-26. doi: 10.1111/j.1600-0854.2010.01059.x. Epub 2010 Mar 10. [Article]
- Eswarakumar VP, Lax I, Schlessinger J: Cellular signaling by fibroblast growth factor receptors. Cytokine Growth Factor Rev. 2005 Apr;16(2):139-49. Epub 2005 Feb 1. [Article]
- Turner N, Grose R: Fibroblast growth factor signalling: from development to cancer. Nat Rev Cancer. 2010 Feb;10(2):116-29. doi: 10.1038/nrc2780. [Article]
- Zhen Y, Sorensen V, Skjerpen CS, Haugsten EM, Jin Y, Walchli S, Olsnes S, Wiedlocha A: Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpnalpha1 and Kpnbeta1. Traffic. 2012 May;13(5):650-64. doi: 10.1111/j.1600-0854.2012.01341.x. Epub 2012 Mar 4. [Article]
- Ago H, Kitagawa Y, Fujishima A, Matsuura Y, Katsube Y: Crystal structure of basic fibroblast growth factor at 1.6 A resolution. J Biochem. 1991 Sep;110(3):360-3. [Article]
- Eriksson AE, Cousens LS, Weaver LH, Matthews BW: Three-dimensional structure of human basic fibroblast growth factor. Proc Natl Acad Sci U S A. 1991 Apr 15;88(8):3441-5. [Article]
- Zhang JD, Cousens LS, Barr PJ, Sprang SR: Three-dimensional structure of human basic fibroblast growth factor, a structural homolog of interleukin 1 beta. Proc Natl Acad Sci U S A. 1991 Apr 15;88(8):3446-50. [Article]
- Zhu X, Komiya H, Chirino A, Faham S, Fox GM, Arakawa T, Hsu BT, Rees DC: Three-dimensional structures of acidic and basic fibroblast growth factors. Science. 1991 Jan 4;251(4989):90-3. [Article]
- Eriksson AE, Cousens LS, Matthews BW: Refinement of the structure of human basic fibroblast growth factor at 1.6 A resolution and analysis of presumed heparin binding sites by selenate substitution. Protein Sci. 1993 Aug;2(8):1274-84. [Article]
- Ibrahimi OA, Eliseenkova AV, Plotnikov AN, Yu K, Ornitz DM, Mohammadi M: Structural basis for fibroblast growth factor receptor 2 activation in Apert syndrome. Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7182-7. Epub 2001 Jun 5. [Article]
- Moy FJ, Seddon AP, Bohlen P, Powers R: High-resolution solution structure of basic fibroblast growth factor determined by multidimensional heteronuclear magnetic resonance spectroscopy. Biochemistry. 1996 Oct 22;35(42):13552-61. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00686 Pentosan polysulfate approved yes antagonist Details DB03935 1,4-Dideoxy-O2-Sulfo-Glucuronic Acid experimental unknown Details DB03959 N,O6-Disulfo-Glucosamine experimental unknown Details DB03981 1,4-Dideoxy-5-Dehydro-O2-Sulfo-Glucuronic Acid experimental unknown Details DB05434 ABT-510 investigational unknown Details DB00364 Sucralfate approved yes agonistinducer Details DB01109 Heparin approved, investigational unknown Details