Outer membrane protein X
Details
- Name
- Outer membrane protein X
- Synonyms
- ybiG
- Gene Name
- ompX
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0011481|Outer membrane protein X MKKIACLSALAAVLAFTAGTSVAATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPL GVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPT YKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
- Number of residues
- 171
- Molecular Weight
- 18602.51
- Theoretical pI
- 7.32
- GO Classification
- Componentscell outer membrane / integral component of membrane
- General Function
- Not Available
- Specific Function
- Not Available
- Pfam Domain Function
- OMP_b-brl (PF13505)
- Transmembrane Regions
- 26-35 45-54 60-69 86-95 100-109 130-139 144-153 161-170
- Cellular Location
- Cell outer membrane
- Gene sequence
>lcl|BSEQ0011482|Outer membrane protein X (ompX) ATGAAAAAAATTGCATGTCTTTCAGCACTGGCCGCAGTTCTGGCTTTCACCGCAGGTACT TCCGTAGCTGCGACTTCTACTGTAACTGGCGGTTACGCACAGAGCGACGCTCAGGGCCAA ATGAACAAAATGGGCGGTTTCAACCTGAAATACCGCTATGAAGAAGACAACAGCCCGCTG GGTGTGATCGGTTCTTTCACTTACACCGAGAAAAGCCGTACTGCAAGCTCTGGTGACTAC AACAAAAACCAGTACTACGGCATCACTGCTGGTCCGGCTTACCGCATTAACGACTGGGCA AGCATCTACGGTGTAGTGGGTGTGGGTTATGGTAAATTCCAGACCACTGAATACCCGACC TACAAACACGACACCAGCGACTACGGTTTCTCCTACGGTGCGGGTCTGCAGTTCAACCCG ATGGAAAACGTTGCTCTGGACTTCTCTTACGAGCAGAGCCGTATTCGTAGCGTTGACGTA GGCACCTGGATTGCCGGTGTTGGTTACCGCTTCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A917 UniProtKB Entry Name OMPX_ECOLI GenBank Protein ID 559694 GenBank Gene ID L37088 - General References
- Mecsas J, Welch R, Erickson JW, Gross CA: Identification and characterization of an outer membrane protein, OmpX, in Escherichia coli that is homologous to a family of outer membrane proteins including Ail of Yersinia enterocolitica. J Bacteriol. 1995 Feb;177(3):799-804. [Article]
- Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al.: A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. DNA Res. 1996 Jun 30;3(3):137-55. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Lomovskaya OL, Kidwell JP, Matin A: Characterization of the sigma 38-dependent expression of a core Escherichia coli starvation gene, pexB. J Bacteriol. 1994 Jul;176(13):3928-35. [Article]
- Molloy MP, Herbert BR, Walsh BJ, Tyler MI, Traini M, Sanchez JC, Hochstrasser DF, Williams KL, Gooley AA: Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis. Electrophoresis. 1998 May;19(5):837-44. [Article]
- Vogt J, Schulz GE: The structure of the outer membrane protein OmpX from Escherichia coli reveals possible mechanisms of virulence. Structure. 1999 Oct 15;7(10):1301-9. [Article]