ATP synthase subunit b
Details
- Name
- ATP synthase subunit b
- Synonyms
- ATP synthase F(0) sector subunit b
- ATPase subunit I
- F-ATPase subunit b
- F-type ATPase subunit b
- papF
- uncF
- Gene Name
- atpF
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0016650|ATP synthase subunit b MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
- Number of residues
- 156
- Molecular Weight
- 17263.735
- Theoretical pI
- 6.04
- GO Classification
- Functionsproton-transporting ATP synthase activity, rotational mechanism / proton-transporting ATPase activity, rotational mechanismProcessesplasma membrane ATP synthesis coupled proton transportComponentsanchored component of membrane / integral component of membrane / plasma membrane / proton-transporting ATP synthase complex, coupling factor F(o)
- General Function
- Proton-transporting atpase activity, rotational mechanism
- Specific Function
- F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0).
- Pfam Domain Function
- ATP-synt_B (PF00430)
- Transmembrane Regions
- 11-31
- Cellular Location
- Cell inner membrane
- Gene sequence
>lcl|BSEQ0016651|ATP synthase subunit b (atpF) GTGAATCTTAACGCAACAATCCTCGGCCAGGCCATCGCGTTTGTCCTGTTCGTTCTGTTC TGCATGAAGTACGTATGGCCGCCATTAATGGCAGCCATCGAAAAACGTCAAAAAGAAATT GCTGACGGCCTTGCTTCCGCAGAACGAGCACATAAGGACCTTGACCTTGCAAAGGCCAGC GCGACCGACCAGCTGAAAAAAGCGAAAGCGGAAGCCCAGGTAATCATCGAGCAGGCGAAC AAACGCCGCTCGCAGATTCTGGACGAAGCGAAAGCTGAGGCAGAACAGGAACGTACTAAA ATCGTGGCCCAGGCGCAGGCGGAAATTGAAGCCGAGCGTAAACGTGCCCGTGAAGAGCTG CGTAAGCAAGTTGCTATCCTGGCTGTTGCTGGCGCCGAGAAGATCATCGAACGTTCCGTG GATGAAGCTGCTAACAGCGACATCGTGGATAAACTTGTCGCTGAACTGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0ABA0 UniProtKB Entry Name ATPF_ECOLI GenBank Gene ID J01594 - General References
- Walker JE, Gay NJ, Saraste M, Eberle AN: DNA sequence around the Escherichia coli unc operon. Completion of the sequence of a 17 kilobase segment containing asnA, oriC, unc, glmS and phoS. Biochem J. 1984 Dec 15;224(3):799-815. [Article]
- Gay NJ, Walker JE: The atp operon: nucleotide sequence of the promoter and the genes for the membrane proteins, and the delta subunit of Escherichia coli ATP-synthase. Nucleic Acids Res. 1981 Aug 25;9(16):3919-26. [Article]
- Kanazawa H, Mabuchi K, Kayano T, Noumi T, Sekiya T, Futai M: Nucleotide sequence of the genes for F0 components of the proton-translocating ATPase from Escherichia coli: prediction of the primary structure of F0 subunits. Biochem Biophys Res Commun. 1981 Nov 30;103(2):613-20. [Article]
- Nielsen J, Hansen FG, Hoppe J, Friedl P, von Meyenburg K: The nucleotide sequence of the atp genes coding for the F0 subunits a, b, c and the F1 subunit delta of the membrane bound ATP synthase of Escherichia coli. Mol Gen Genet. 1981;184(1):33-9. [Article]
- Kanazawa H, Futai M: Structure and function of H+-ATPase: what we have learned from Escherichia coli H+-ATPase. Ann N Y Acad Sci. 1982;402:45-64. [Article]
- Porter AC, Kumamoto C, Aldape K, Simoni RD: Role of the b subunit of the Escherichia coli proton-translocating ATPase. A mutagenic analysis. J Biol Chem. 1985 Jul 5;260(13):8182-7. [Article]
- Burland V, Plunkett G 3rd, Daniels DL, Blattner FR: DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication. Genomics. 1993 Jun;16(3):551-61. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Mabuchi K, Kanazawa H, Kayano T, Futai M: Nucleotide sequence of the gene coding for the delta subunit of proton translocating ATPase of Escherichia coli. Biochem Biophys Res Commun. 1981 Sep 16;102(1):172-9. [Article]
- McCormick KA, Cain BD: Targeted mutagenesis of the b subunit of F1F0 ATP synthase in Escherichia coli: Glu-77 through Gln-85. J Bacteriol. 1991 Nov;173(22):7240-8. [Article]
- Stenberg F, Chovanec P, Maslen SL, Robinson CV, Ilag LL, von Heijne G, Daley DO: Protein complexes of the Escherichia coli cell envelope. J Biol Chem. 2005 Oct 14;280(41):34409-19. Epub 2005 Aug 3. [Article]
- Dmitriev O, Jones PC, Jiang W, Fillingame RH: Structure of the membrane domain of subunit b of the Escherichia coli F0F1 ATP synthase. J Biol Chem. 1999 May 28;274(22):15598-604. [Article]