5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
Details
- Name
- 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
- Synonyms
- 3.2.2.9
- 5'-methylthioadenosine nucleosidase
- AdoHcy nucleosidase
- MTA nucleosidase
- MTA/SAH nucleosidase
- mtn
- P46
- pfs
- S-adenosylhomocysteine nucleosidase
- SAH nucleosidase
- SRH nucleosidase
- yadA
- Gene Name
- mtnN
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0003973|5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGAT LLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFK ADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAH VCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG
- Number of residues
- 232
- Molecular Weight
- 24353.725
- Theoretical pI
- 4.9
- GO Classification
- Functionsadenosylhomocysteine nucleosidase activity / methylthioadenosine nucleosidase activityProcessesL-methionine biosynthetic process from methylthioadenosine / L-methionine biosynthetic process from S-adenosylmethionine / nucleoside catabolic processComponentscytosol
- General Function
- Methylthioadenosine nucleosidase activity
- Specific Function
- Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively. Can also use 5'-isobutylthioadenosine, 5'-n-butylthioadenosine, S-adenosyl-D-homocysteine, decarboxylated adenosylhomocysteine, deaminated adenosylhomocysteine and S-2-aza-adenosylhomocysteine as substrates.
- Pfam Domain Function
- PNP_UDP_1 (PF01048)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
>lcl|BSEQ0021317|5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (mtnN) ATGAAAATCGGCATCATTGGTGCAATGGAAGAAGAAGTTACGCTGCTGCGTGACAAAATC GAAAACCGTCAAACTATCAGTCTCGGCGGTTGCGAAATCTATACCGGCCAACTGAATGGA ACCGAGGTTGCGCTTCTGAAATCGGGCATCGGTAAAGTCGCTGCGGCGCTGGGTGCCACT TTGCTGTTGGAACACTGCAAGCCAGATGTGATTATTAACACCGGTTCTGCCGGTGGCCTG GCACCAACGTTGAAAGTGGGCGATATCGTTGTCTCGGACGAAGCACGTTATCACGACGCG GATGTCACGGCATTTGGTTATGAATACGGTCAGTTACCAGGCTGTCCGGCAGGCTTTAAA GCTGACGATAAACTGATCGCTGCCGCTGAGGCCTGCATTGCCGAACTGAATCTTAACGCT GTACGTGGCCTGATTGTTAGCGGCGACGCTTTCATCAACGGTTCTGTTGGTCTGGCGAAA ATCCGCCACAACTTCCCACAGGCCATTGCTGTAGAGATGGAAGCGACGGCAATCGCCCAT GTCTGCCACAATTTCAACGTCCCGTTTGTTGTCGTACGCGCCATCTCCGACGTGGCCGAT CAACAGTCTCATCTTAGCTTCGATGAGTTCCTGGCTGTTGCCGCTAAACAGTCCAGCCTG ATGGTTGAGTCACTGGTGCAGAAACTTGCACATGGCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0AF12 UniProtKB Entry Name MTNN_ECOLI GenBank Protein ID 2981267 GenBank Gene ID U24438 - General References
- Wurgler SM, Richardson CC: Structure and regulation of the gene for dGTP triphosphohydrolase from Escherichia coli. Proc Natl Acad Sci U S A. 1990 Apr;87(7):2740-4. [Article]
- Cornell KA, Riscoe MK: Cloning and expression of Escherichia coli 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase: identification of the pfs gene product. Biochim Biophys Acta. 1998 Mar 4;1396(1):8-14. [Article]
- Fujita N, Mori H, Yura T, Ishihama A: Systematic sequencing of the Escherichia coli genome: analysis of the 2.4-4.1 min (110,917-193,643 bp) region. Nucleic Acids Res. 1994 May 11;22(9):1637-9. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Della Ragione F, Porcelli M, Carteni-Farina M, Zappia V, Pegg AE: Escherichia coli S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase. Purification, substrate specificity and mechanism of action. Biochem J. 1985 Dec 1;232(2):335-41. [Article]
- Cornell KA, Swarts WE, Barry RD, Riscoe MK: Characterization of recombinant Eschericha coli 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase: analysis of enzymatic activity and substrate specificity. Biochem Biophys Res Commun. 1996 Nov 21;228(3):724-32. [Article]
- VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
- Lee JE, Luong W, Huang DJ, Cornell KA, Riscoe MK, Howell PL: Mutational analysis of a nucleosidase involved in quorum-sensing autoinducer-2 biosynthesis. Biochemistry. 2005 Aug 23;44(33):11049-57. [Article]
- Lee JE, Cornell KA, Riscoe MK, Howell PL: Structure of E. coli 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase reveals similarity to the purine nucleoside phosphorylases. Structure. 2001 Oct;9(10):941-53. [Article]
- Lee JE, Cornell KA, Riscoe MK, Howell PL: Structure of Escherichia coli 5'-methylthioadenosine/ S-adenosylhomocysteine nucleosidase inhibitor complexes provide insight into the conformational changes required for substrate binding and catalysis. J Biol Chem. 2003 Mar 7;278(10):8761-70. Epub 2002 Dec 20. [Article]
- Singh V, Evans GB, Lenz DH, Mason JM, Clinch K, Mee S, Painter GF, Tyler PC, Furneaux RH, Lee JE, Howell PL, Schramm VL: Femtomolar transition state analogue inhibitors of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Escherichia coli. J Biol Chem. 2005 May 6;280(18):18265-73. Epub 2005 Mar 4. [Article]
- Lee JE, Smith GD, Horvatin C, Huang DJ, Cornell KA, Riscoe MK, Howell PL: Structural snapshots of MTA/AdoHcy nucleosidase along the reaction coordinate provide insights into enzyme and nucleoside flexibility during catalysis. J Mol Biol. 2005 Sep 23;352(3):559-74. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB02158 (2S,3S,4R,5S)-2-(4-Amino-4,5-dihydro-1H-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(methylsulfanyl)methyl]-3,4-pyrrolidinediol experimental unknown Details DB02281 Formycin experimental unknown Details DB00173 Adenine approved, nutraceutical unknown Details DB02933 5'-Deoxy-5'-(Methylthio)-Tubercidin experimental unknown Details DB08606 (3R,4S)-1-[(4-AMINO-5H-PYRROLO[3,2-D]PYRIMIDIN-7-YL)METHYL]-4-[(METHYLSULFANYL)METHYL]PYRROLIDIN-3-OL experimental unknown Details