GTPase Obg
Details
- Name
- GTPase Obg
- Synonyms
- 3.6.5.-
- GTP-binding protein Obg
- OrfA
- Spo0B-associated GTP-binding protein
- Gene Name
- obg
- Organism
- Bacillus subtilis (strain 168)
- Amino acid sequence
>lcl|BSEQ0011284|GTPase Obg MFVDQVKVYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVVFEVDEGLRTLMDFRY KKHFKAIRGEHGMSKNQHGRNADDMVIKVPPGTVVTDDDTKQVIADLTEHGQRAVIARGG RGGRGNSRFATPANPAPQLSENGEPGKERYIVLELKVLADVGLVGFPSVGKSTLLSVVSS AKPKIADYHFTTLVPNLGMVETDDGRSFVMADLPGLIEGAHQGVGLGHQFLRHIERTRVI VHVIDMSGLEGRDPYDDYLTINQELSEYNLRLTERPQIIVANKMDMPEAAENLEAFKEKL TDDYPVFPISAVTREGLRELLFEVANQLENTPEFPLYDEEELTQNRVMYTMENEEVPFNI TRDPDGVFVLSGDSLERLFKMTDFSRDESVKRFARQMRGMGVDEALRERGAKDGDIIRLL EFEFEFID
- Number of residues
- 428
- Molecular Weight
- 47688.635
- Theoretical pI
- 4.8
- GO Classification
- FunctionsGTP binding / GTPase activity / magnesium ion bindingProcessesribosome biogenesis / sporulation resulting in formation of a cellular sporeComponentscytoplasm
- General Function
- Magnesium ion binding
- Specific Function
- Necessary for the transition from vegetative growth to stage 0 or stage II of sporulation, but sporulation subsequent to these stages is unaffected at 45 degrees Celsius. This ts effect is probably due solely to the E-79 mutation. Required for expression of early sporulation genes, further suggesting a role in the induction of sporulation. Depletion effects on sporulation can be partially suppressed by missense mutations in spo0A. Strains depleted for obg stop growing after about 3 hours and do not induce the sigma-B factor following ethanol stress. It cofractionates with the ribosome and upstream stress response regulators RsbR, RsbS and RsbT in size fractionation columns, suggesting the ribosome might serve as a possible mediator of the activity of obg and the stress induction of sigma-B. In glycerol gradients partially associates with ribosomes; this is stabilized by a nonhydrolyzable GTP-analog and to a lesser extent GTP and GDP.An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate. Plays a role in control of the cell cycle, stress response, ribosome biogenesis and in those bacteria that undergo differentiation, in morphogenesis control.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0011285|GTPase Obg (obg) ATGTTTGTAGATCAGGTCAAAGTATATGTAAAAGGCGGCGACGGCGGCAACGGTATGGTT GCGTTTCGCCGTGAAAAATATGTGCCGAAAGGCGGCCCTGCCGGCGGTGACGGAGGAAAG GGAGGAGACGTCGTTTTTGAAGTAGATGAAGGTCTCCGCACCCTGATGGATTTTAGATAC AAAAAACACTTTAAAGCGATTCGCGGCGAGCATGGCATGTCCAAAAACCAGCACGGGCGA AATGCTGATGATATGGTCATTAAAGTTCCGCCGGGCACCGTTGTGACAGACGATGATACA AAACAGGTCATCGCTGATTTAACAGAGCACGGACAGCGGGCTGTCATTGCAAGAGGCGGA AGAGGCGGAAGAGGAAATAGCCGCTTTGCTACACCGGCTAATCCCGCGCCTCAGCTTTCA GAAAACGGCGAGCCGGGAAAAGAACGCTACATTGTTCTTGAATTAAAAGTGCTTGCAGAT GTCGGACTTGTCGGGTTCCCGAGTGTGGGAAAATCTACTTTGCTGTCTGTTGTCTCATCT GCAAAACCGAAAATTGCGGACTATCACTTTACAACGCTTGTCCCGAATCTCGGCATGGTT GAAACGGATGACGGACGCAGCTTTGTCATGGCTGATTTGCCAGGGCTGATTGAAGGCGCA CACCAAGGCGTCGGACTGGGCCACCAGTTTTTGCGCCATATTGAACGGACGAGGGTTATT GTTCATGTCATTGACATGTCAGGCTTAGAAGGCCGTGATCCATATGATGATTATCTTACG ATTAACCAGGAGCTGAGCGAGTACAATCTGCGTCTCACTGAGCGTCCGCAAATTATCGTT GCAAATAAAATGGACATGCCGGAGGCTGCGGAAAATCTCGAAGCCTTTAAAGAAAAGCTG ACGGATGATTATCCGGTATTCCCGATCAGTGCGGTGACAAGAGAAGGTCTGCGTGAGCTT CTGTTTGAGGTTGCCAATCAGCTTGAGAACACACCGGAATTCCCGCTGTATGACGAGGAA GAGCTTACACAAAACCGTGTCATGTACACGATGGAAAATGAAGAAGTGCCATTTAACATT ACACGCGATCCAGACGGTGTATTTGTGCTTTCAGGAGACAGCCTTGAGCGGTTATTCAAG ATGACTGATTTCTCACGTGATGAATCGGTTAAACGGTTTGCAAGACAGATGCGCGGAATG GGTGTTGATGAAGCACTCAGAGAACGCGGAGCCAAGGATGGAGATATAATCAGGCTTCTG GAATTTGAATTTGAATTTATTGATTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P20964 UniProtKB Entry Name OBG_BACSU GenBank Protein ID 508979 GenBank Gene ID M24537 - General References
- Trach K, Hoch JA: The Bacillus subtilis spo0B stage 0 sporulation operon encodes an essential GTP-binding protein. J Bacteriol. 1989 Mar;171(3):1362-71. [Article]
- Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [Article]
- Ferrari FA, Trach K, Hoch JA: Sequence analysis of the spo0B locus reveals a polycistronic transcription unit. J Bacteriol. 1985 Feb;161(2):556-62. [Article]
- Kok J, Trach KA, Hoch JA: Effects on Bacillus subtilis of a conditional lethal mutation in the essential GTP-binding protein Obg. J Bacteriol. 1994 Dec;176(23):7155-60. [Article]
- Welsh KM, Trach KA, Folger C, Hoch JA: Biochemical characterization of the essential GTP-binding protein Obg of Bacillus subtilis. J Bacteriol. 1994 Dec;176(23):7161-8. [Article]
- Vidwans SJ, Ireton K, Grossman AD: Possible role for the essential GTP-binding protein Obg in regulating the initiation of sporulation in Bacillus subtilis. J Bacteriol. 1995 Jun;177(11):3308-11. [Article]
- Scott JM, Haldenwang WG: Obg, an essential GTP binding protein of Bacillus subtilis, is necessary for stress activation of transcription factor sigma(B). J Bacteriol. 1999 Aug;181(15):4653-60. [Article]
- Scott JM, Ju J, Mitchell T, Haldenwang WG: The Bacillus subtilis GTP binding protein obg and regulators of the sigma(B) stress response transcription factor cofractionate with ribosomes. J Bacteriol. 2000 May;182(10):2771-7. [Article]
- Morimoto T, Loh PC, Hirai T, Asai K, Kobayashi K, Moriya S, Ogasawara N: Six GTP-binding proteins of the Era/Obg family are essential for cell growth in Bacillus subtilis. Microbiology. 2002 Nov;148(Pt 11):3539-52. [Article]
- Zhang S, Haldenwang WG: Guanine nucleotides stabilize the binding of Bacillus subtilis Obg to ribosomes. Biochem Biophys Res Commun. 2004 Sep 17;322(2):565-9. [Article]
- Kuo S, Demeler B, Haldenwang WG: The growth-promoting and stress response activities of the Bacillus subtilis GTP binding protein Obg are separable by mutation. J Bacteriol. 2008 Oct;190(20):6625-35. doi: 10.1128/JB.00799-08. Epub 2008 Aug 8. [Article]
- Lee Y, Bang WY, Kim S, Lazar P, Kim CW, Bahk JD, Lee KW: Molecular modeling study for interaction between Bacillus subtilis Obg and Nucleotides. PLoS One. 2010 Sep 7;5(9):e12597. doi: 10.1371/journal.pone.0012597. [Article]
- Buglino J, Shen V, Hakimian P, Lima CD: Structural and biochemical analysis of the Obg GTP binding protein. Structure. 2002 Nov;10(11):1581-92. [Article]
- Czyz A, Wegrzyn G: The Obg subfamily of bacterial GTP-binding proteins: essential proteins of largely unknown functions that are evolutionarily conserved from bacteria to humans. Acta Biochim Pol. 2005;52(1):35-43. [Article]
- Michel B: Obg/CtgA, a signaling protein that controls replication, translation, and morphological development? Dev Cell. 2005 Mar;8(3):300-1. [Article]