ATP synthase subunit c, sodium ion specific
Details
- Name
- ATP synthase subunit c, sodium ion specific
- Synonyms
- ATP synthase F(0) sector subunit c
- F-ATPase subunit c
- F-type ATPase subunit c
- Lipid-binding protein
- uncE
- Gene Name
- atpE
- Organism
- Propionigenium modestum
- Amino acid sequence
>lcl|BSEQ0011326|ATP synthase subunit c, sodium ion specific MDMVLAKTVVLAASAVGAGAAMIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLG QAIAESTGIYSLVIALILLYANPFVGLLG
- Number of residues
- 89
- Molecular Weight
- 8731.24
- Theoretical pI
- 4.67
- GO Classification
- Functionshydrogen ion transmembrane transporter activity / lipid bindingProcessesATP hydrolysis coupled proton transport / ATP synthesis coupled proton transport / sodium ion transportComponentsintegral component of membrane / plasma membrane / proton-transporting ATP synthase complex, coupling factor F(o)
- General Function
- Lipid binding
- Specific Function
- F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane sodium channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to sodium translocation.Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits (Probable).
- Pfam Domain Function
- ATP-synt_C (PF00137)
- Transmembrane Regions
- 9-29 68-88
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0003656|270 bp ATGGATATGGTATTAGCTAAAACTGTAGTATTAGCAGCATCAGCTGTTGGTGCAGGAGCA GCAATGATCGCAGGTATTGGACCAGGGGTTGGACAAGGGTATGCAGCAGGTAAAGCGGTA GAATCTGTTGCCAGACAACCAGAAGCAAAAGGGGACATCATCTCTACAATGGTACTAGGA CAAGCGATTGCGGAATCAACTGGTATCTACTCACTAGTTATTGCGTTAATCCTACTTTAC GCAAACCCATTTGTTGGATTACTTGGGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P21905 UniProtKB Entry Name ATPL_PROMO GenBank Protein ID 45612 GenBank Gene ID X53845 - General References
- Ludwig W, Kaim G, Laubinger W, Dimroth P, Hoppe J, Schleifer KH: Sequence of subunit c of the sodium ion translocating adenosine triphosphate synthase of Propionigenium modestum. Eur J Biochem. 1990 Oct 24;193(2):395-9. [Article]
- Kaim G, Ludwig W, Dimroth P, Schleifer KH: Cloning, sequencing and in vivo expression of genes encoding the F0 part of the sodium-ion-dependent ATP synthase of Propionigenium modestum in Escherichia coli. Eur J Biochem. 1992 Jul 15;207(2):463-70. [Article]
- Esser U, Krumholz LR, Simoni RD: Nucleotide sequence of the F0 subunits of the sodium dependent F1F0 ATPase of Propionigenium modestum. Nucleic Acids Res. 1990 Oct 11;18(19):5887. [Article]
- Gerike U, Dimroth P: N-terminal amino acid sequences of the subunits of the Na(+)-translocating F1F0 ATPase from Propionigenium modestum. FEBS Lett. 1993 Jan 18;316(1):89-92. [Article]
- Krumholz LR, Esser U, Simoni RD: Characterization of the genes coding for the F1F0 subunits of the sodium dependent ATPase of Propionigenium modestum. FEMS Microbiol Lett. 1992 Feb 1;70(1):37-41. [Article]