Streptavidin
Details
- Name
- Streptavidin
- Synonyms
- Streptavidin precursor
- Gene Name
- Not Available
- Organism
- Streptomyces avidinii
- Amino acid sequence
>lcl|BSEQ0011189|Streptavidin MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGAD GALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQY VGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDA VQQ
- Number of residues
- 183
- Molecular Weight
- 18833.61
- Theoretical pI
- 8.81
- GO Classification
- Componentsextracellular region
- General Function
- Not Available
- Specific Function
- The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).
- Pfam Domain Function
- Avidin (PF01382)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0003308|552 bp ATGCGCAAGATCGTCGTTGCAGCCATCGCCGTTTCCCTGACCACGGTCTCGATTACGGCC AGCGCTTCGGCAGACCCCTCCAAGGACTCGAAGGCCCAGGTCTCGGCCGCCGAGGCCGGC ATCACCGGCACCTGGTACAACCAGCTCGGCTCGACCTTCATCGTGACCGCGGGCGCCGAC GGCGCCCTGACCGGAACCTACGAGTCGGCCGTCGGCAACGCCGAGAGCCGCTACGTCCTG ACCGGTCGTTACGACAGCGCCCCGGCCACCGACGGCAGCGGCACCGCCCTCGGTTGGACG GTGGCCTGGAAGAATAACTACCGCAACGCCCACTCCGCGACCACGTGGAGCGGCCAGTAC GTCGGCGGCGCCGAGGCGAGGATCAACACCCAGTGGCTGCTGACCTCCGGCACCACCGAG GCCAACGCCTGGAAGTCCACGCTGGTCGGCCACGACACCTTCACCAAGGTGAAGCCGTCC GCCGCCTCCATCGACGCGGCGAAGAAGGCCGGCGTCAACAACGGCAACCCGCTCGACGCC GTTCAGCAGTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P22629 UniProtKB Entry Name SAV_STRAV GenBank Protein ID 46741 GenBank Gene ID X03591 - General References
- Argarana CE, Kuntz ID, Birken S, Axel R, Cantor CR: Molecular cloning and nucleotide sequence of the streptavidin gene. Nucleic Acids Res. 1986 Feb 25;14(4):1871-82. [Article]
- Gitlin G, Bayer EA, Wilchek M: Studies on the biotin-binding site of streptavidin. Tryptophan residues involved in the active site. Biochem J. 1988 Nov 15;256(1):279-82. [Article]
- Gitlin G, Bayer EA, Wilchek M: Studies on the biotin-binding sites of avidin and streptavidin. Tyrosine residues are involved in the binding site. Biochem J. 1990 Jul 15;269(2):527-30. [Article]
- Alon R, Bayer EA, Wilchek M: Streptavidin contains an RYD sequence which mimics the RGD receptor domain of fibronectin. Biochem Biophys Res Commun. 1990 Aug 16;170(3):1236-41. [Article]
- Weber PC, Ohlendorf DH, Wendoloski JJ, Salemme FR: Structural origins of high-affinity biotin binding to streptavidin. Science. 1989 Jan 6;243(4887):85-8. [Article]
- Freitag S, Le Trong I, Klumb L, Stayton PS, Stenkamp RE: Structural studies of the streptavidin binding loop. Protein Sci. 1997 Jun;6(6):1157-66. [Article]
- Katz BA, Cass RT: In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0. J Biol Chem. 1997 May 16;272(20):13220-8. [Article]
- Katz BA: Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH. J Mol Biol. 1997 Dec 19;274(5):776-800. [Article]
- Freitag S, Le Trong I, Chilkoti A, Klumb LA, Stayton PS, Stenkamp RE: Structural studies of binding site tryptophan mutants in the high-affinity streptavidin-biotin complex. J Mol Biol. 1998 May 29;279(1):211-21. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01942 Formic acid experimental, investigational unknown Details DB02674 4-(2-Oxo-Hexahydro-Thieno[3,4-D]Imidazol-4-Yl)-Butyricacid experimental unknown Details DB03112 6-(2-Oxo-Hexahydro-Thieno[3,4-D]Imidazol-4-Yl)-Hexanoic Acid experimental unknown Details DB03139 6-[5-(2-Oxo-Hexahydro-Thieno[3,4-D]Imidazol-4-Yl)-Pentanoylamino]-Hexanoic Acid experimental unknown Details DB03353 2-Iminobiotin experimental, investigational unknown Details DB03533 Acetyleneurea experimental unknown Details DB03549 Biotinyl P-Nitroaniline experimental unknown Details DB04650 5-[(3AS,4R,6AR)-2-OXOHEXAHYDRO-1H-THIENO[3,4-D]IMIDAZOL-4-YL]PENTANOIC ACID experimental unknown Details DB07667 2-((3',5'-DIMETHYL-4'-HYDROXYPHENYL)AZO)BENZOIC ACID experimental unknown Details DB04464 N-Formylmethionine experimental unknown Details DB07880 2-((4'-HYDROXYPHENYL)-AZO)BENZOIC ACID experimental unknown Details DB08181 2-((3'-METHYL-4'-HYDROXYPHENYL)AZO)BENZOIC ACID experimental unknown Details DB08196 2-((3',5'-DIMETHOXY-4'-HYDROXYPHENYL)AZO)BENZOIC ACID experimental unknown Details DB08216 2-((3'-TERTBUTYL-4'-HYDROXYPHENYL)AZO)BENZOIC ACID experimental unknown Details DB08252 2-((4'-HYDROXYNAPHTHYL)-AZO)BENZOIC ACID experimental unknown Details