Chorismate pyruvate-lyase
Details
- Name
- Chorismate pyruvate-lyase
- Synonyms
- 4.1.3.40
- CL
- Gene Name
- ubiC
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0002992|Chorismate pyruvate-lyase MSHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNE IPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLF TSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY
- Number of residues
- 165
- Molecular Weight
- 18776.68
- Theoretical pI
- 8.2
- GO Classification
- Functionschorismate lyase activityProcessespyruvate biosynthetic process / ubiquinone biosynthetic processComponentscytosol
- General Function
- Chorismate lyase activity
- Specific Function
- Removes the pyruvyl group from chorismate, with concomitant aromatization of the ring, to provide 4-hydroxybenzoate (4HB) for the ubiquinone pathway.
- Pfam Domain Function
- Chor_lyase (PF04345)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0021294|Chorismate pyruvate-lyase (ubiC) ATGTCACACCCCGCGTTAACGCAACTGCGTGCGCTGCGCTATTGTAAAGAGATCCCTGCC CTGGATCCGCAACTGCTCGACTGGCTGTTGCTGGAGGATTCCATGACAAAACGTTTTGAA CAGCAGGGAAAAACGGTAAGCGTGACGATGATCCGCGAAGGGTTTGTCGAGCAGAATGAA ATCCCCGAAGAACTGCCGCTGCTGCCGAAAGAGTCTCGTTACTGGTTACGTGAAATTTTG TTATGTGCCGATGGTGAACCGTGGCTTGCCGGTCGTACCGTCGTTCCTGTGTCAACGTTA AGCGGGCCGGAGCTGGCGTTACAAAAATTGGGTAAAACGCCGTTAGGACGCTATCTGTTC ACATCATCGACATTAACCCGGGACTTTATTGAGATAGGCCGTGATGCCGGGCTGTGGGGG CGACGTTCCCGCCTGCGATTAAGCGGTAAACCGCTGTTGCTAACAGAACTGTTTTTACCG GCGTCACCGTTGTACTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P26602 UniProtKB Entry Name UBIC_ECOLI GenBank Protein ID 43231 GenBank Gene ID X66619 - General References
- Siebert M, Bechthold A, Melzer M, May U, Berger U, Schroder G, Schroder J, Severin K, Heide L: Ubiquinone biosynthesis. Cloning of the genes coding for chorismate pyruvate-lyase and 4-hydroxybenzoate octaprenyl transferase from Escherichia coli. FEBS Lett. 1992 Aug 3;307(3):347-50. [Article]
- Nichols BP, Green JM: Cloning and sequencing of Escherichia coli ubiC and purification of chorismate lyase. J Bacteriol. 1992 Aug;174(16):5309-16. [Article]
- Nishimura K, Nakahigashi K, Inokuchi H: Location of the ubiA gene on the physical map of Escherichia coli. J Bacteriol. 1992 Sep;174(17):5762. [Article]
- Wu G, Williams HD, Gibson F, Poole RK: Mutants of Escherichia coli affected in respiration: the cloning and nucleotide sequence of ubiA, encoding the membrane-bound p-hydroxybenzoate:octaprenyltransferase. J Gen Microbiol. 1993 Aug;139(8):1795-805. [Article]
- Blattner FR, Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL: Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes. Nucleic Acids Res. 1993 Nov 25;21(23):5408-17. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Siebert M, Severin K, Heide L: Formation of 4-hydroxybenzoate in Escherichia coli: characterization of the ubiC gene and its encoded enzyme chorismate pyruvate-lyase. Microbiology. 1994 Apr;140 ( Pt 4):897-904. [Article]
- Holden MJ, Mayhew MP, Gallagher DT, Vilker VL: Chorismate lyase: kinetics and engineering for stability. Biochim Biophys Acta. 2002 Jan 31;1594(1):160-7. [Article]
- Stover C, Mayhew MP, Holden MJ, Howard A, Gallagher DT: Crystallization and 1.1-A diffraction of chorismate lyase from Escherichia coli. J Struct Biol. 2000 Feb;129(1):96-9. [Article]
- Gallagher DT, Mayhew M, Holden MJ, Howard A, Kim KJ, Vilker VL: The crystal structure of chorismate lyase shows a new fold and a tightly retained product. Proteins. 2001 Aug 15;44(3):304-11. [Article]
- Smith N, Roitberg AE, Rivera E, Howard A, Holden MJ, Mayhew M, Kaistha S, Gallagher DT: Structural analysis of ligand binding and catalysis in chorismate lyase. Arch Biochem Biophys. 2006 Jan 1;445(1):72-80. Epub 2005 Nov 22. [Article]