Glycerol-3-phosphate cytidylyltransferase
Details
- Name
- Glycerol-3-phosphate cytidylyltransferase
- Synonyms
- 2.7.7.39
- CDP-glycerol pyrophosphorylase
- GCT
- Teichoic acid biosynthesis protein D
- Gene Name
- tagD
- Organism
- Bacillus subtilis (strain 168)
- Amino acid sequence
>lcl|BSEQ0019152|Glycerol-3-phosphate cytidylyltransferase MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILE TIRYVDEVIPEKNWEQKKQDIIDHNIDVFVMGDDWEGKFDFLKDQCEVVYLPRTEGISTT KIKEEIAGL
- Number of residues
- 129
- Molecular Weight
- 15271.45
- Theoretical pI
- 6.01
- GO Classification
- Functionsglycerol-3-phosphate cytidylyltransferase activity / metal ion bindingProcessescell wall organization / teichoic acid biosynthetic processComponentscytoplasm
- General Function
- Metal ion binding
- Specific Function
- Provides activated glycerol phosphate for teichoic acid synthesis, via incorporation into both the linkage unit and the teichoic acid polymer by TagB and TagF.
- Pfam Domain Function
- CTP_transf_like (PF01467)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0019153|Glycerol-3-phosphate cytidylyltransferase (tagD) ATGAAAAAAGTTATCACATATGGAACTTTTGATTTACTGCATTGGGGTCACATTAAATTG CTTGAGCGTGCAAAGCAGCTTGGTGATTATTTAGTTGTTGCTATTTCAACGGATGAATTC AATTTACAAAAGCAAAAAAAAGCTTATCACAGCTATGAGCACCGTAAATTAATTTTAGAA ACCATTCGATATGTGGACGAAGTAATTCCTGAAAAGAATTGGGAGCAAAAAAAGCAAGAT ATTATTGATCATAATATTGATGTTTTTGTTATGGGGGATGACTGGGAAGGTAAATTTGAC TTTCTCAAAGATCAGTGTGAGGTTGTTTACCTCCCAAGAACAGAAGGCATCTCTACAACA AAGATCAAAGAGGAAATTGCTGGTTTATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P27623 UniProtKB Entry Name TAGD_BACSU GenBank Protein ID 143723 GenBank Gene ID M57497 - General References
- Mauel C, Young M, Karamata D: Genes concerned with synthesis of poly(glycerol phosphate), the essential teichoic acid in Bacillus subtilis strain 168, are organized in two divergent transcription units. J Gen Microbiol. 1991 Apr;137(4):929-41. [Article]
- Park YS, Sweitzer TD, Dixon JE, Kent C: Expression, purification, and characterization of CTP:glycerol-3-phosphate cytidylyltransferase from Bacillus subtilis. J Biol Chem. 1993 Aug 5;268(22):16648-54. [Article]
- Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [Article]
- Park YS, Gee P, Sanker S, Schurter EJ, Zuiderweg ER, Kent C: Identification of functional conserved residues of CTP:glycerol-3-phosphate cytidylyltransferase. Role of histidines in the conserved HXGH in catalysis. J Biol Chem. 1997 Jun 13;272(24):15161-6. [Article]
- Sanker S, Campbell HA, Kent C: Negative cooperativity of substrate binding but not enzyme activity in wild-type and mutant forms of CTP:glycerol-3-phosphate cytidylyltransferase. J Biol Chem. 2001 Oct 12;276(41):37922-8. Epub 2001 Aug 3. [Article]
- Howell A, Dubrac S, Andersen KK, Noone D, Fert J, Msadek T, Devine K: Genes controlled by the essential YycG/YycF two-component system of Bacillus subtilis revealed through a novel hybrid regulator approach. Mol Microbiol. 2003 Sep;49(6):1639-55. [Article]
- Weber CH, Park YS, Sanker S, Kent C, Ludwig ML: A prototypical cytidylyltransferase: CTP:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis. Structure. 1999 Sep 15;7(9):1113-24. [Article]
- Pattridge KA, Weber CH, Friesen JA, Sanker S, Kent C, Ludwig ML: Glycerol-3-phosphate cytidylyltransferase. Structural changes induced by binding of CDP-glycerol and the role of lysine residues in catalysis. J Biol Chem. 2003 Dec 19;278(51):51863-71. Epub 2003 Sep 23. [Article]