Vasopressin V1a receptor
Details
- Name
- Vasopressin V1a receptor
- Synonyms
- Antidiuretic hormone receptor 1a
- AVPR V1a
- AVPR1
- V1aR
- Vascular/hepatic-type arginine vasopressin receptor
- Gene Name
- AVPR1A
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0009979|Vasopressin V1a receptor MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
- Number of residues
- 418
- Molecular Weight
- 46799.105
- Theoretical pI
- 9.67
- GO Classification
- Functionspeptide binding / peptide hormone binding / protein kinase C binding / vasopressin receptor activityProcessesactivation of phospholipase C activity / blood circulation / calcium-mediated signaling / cellular response to hormone stimulus / cellular response to water deprivation / G-protein coupled receptor signaling pathway / generation of precursor metabolites and energy / grooming behavior / maternal aggressive behavior / maternal behavior / myotube differentiation / negative regulation of female receptivity / negative regulation of transmission of nerve impulse / penile erection / positive regulation of cell growth / positive regulation of cell proliferation / positive regulation of cellular pH reduction / positive regulation of cytosolic calcium ion concentration / positive regulation of glutamate secretion / positive regulation of heart rate / positive regulation of prostaglandin biosynthetic process / positive regulation of renal sodium excretion / positive regulation of systemic arterial blood pressure / positive regulation of vasoconstriction / regulation of systemic arterial blood pressure by vasopressin / response to corticosterone / response to peptide / social behavior / sperm ejaculation / telencephalon developmentComponentscytoplasmic vesicle / cytosol / endosome / integral component of plasma membrane / plasma membrane
- General Function
- Vasopressin receptor activity
- Specific Function
- Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Has been involved in social behaviors, including affiliation and attachment.
- Pfam Domain Function
- Transmembrane Regions
- 53-76 89-110 126-147 169-190 219-239 294-313 332-351
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0009980|Vasopressin V1a receptor (AVPR1A) ATGCGTCTCTCCGCCGGTCCCGACGCGGGGCCCTCGGGCAACTCCAGCCCATGGTGGCCT CTGGCCACCGGCGCTGGCAACACAAGCCGGGAGGCCGAAGCCCTCGGGGAGGGCAACGGC CCACCGAGGGACGTGCGCAACGAGGAGCTGGCCAAACTGGAGATCGCCGTGCTGGCGGTG ACTTTCGCGGTGGCCGTGCTGGGCAACAGCAGCGTACTGCTGGCTCTGCACCGGACGCCG CGCAAGACGTCCCGCATGCACCTCTTCATCCGACACCTCAGCCTGGCCGACCTGGCCGTG GCATTCTTCCAGGTGCTGCCGCAAATGTGCTGGGACATCACCTACCGCTTCCGCGGCCCC GACTGGCTGTGCCGCGTGGTGAAGCACCTGCAGGTGTTCGGCATGTTTGCGTCGGCCTAC ATGCTGGTAGTCATGACAGCCGACCGCTACATCGCGGTGTGCCACCCGCTCAAGACTCTG CAACAGCCCGCGCGCCGCTCGCGCCTCATGATCGCGGCCGCCTGGGTGCTGAGCTTCGTG CTGAGCACGCCGCAGTACTTCGTCTTCTCCATGATCGAGGTGAACAATGTCACCAAGGCC CGCGACTGCTGGGCCACCTTCATCCAGCCCTGGGGTTCTCGTGCCTACGTGACCTGGATG ACGGGCGGCATCTTTGTGGCGCCCGTGGTCATCTTGGGTACCTGCTACGGCTTCATCTGC TACAACATCTGGTGCAACGTCCGCGGGAAGACGGCGTCGCGCCAGAGCAAGGGTGCAGAG CAAGCGGGTGTGGCCTTCCAAAAGGGGTTCCTGCTCGCACCCTGTGTCAGCAGCGTGAAG TCCATTTCCCGGGCCAAGATCCGCACGGTGAAGATGACTTTTGTGATCGTGACGGCTTAC ATCGTCTGCTGGGCGCCTTTCTTCATCATCCAGATGTGGTCTGTCTGGGATCCCATGTCC GTCTGGACCGAATCGGAAAACCCTACCATCACCATCACTGCATTACTGGGTTCCTTGAAT AGCTGCTGTAATCCCTGGATATACATGTTTTTTAGTGGCCATCTCCTTCAAGACTGTGTT CAAAGCTTCCCATGCTGCCAAAACATGAAGGAAAAATTCAACAAAGAAGATACTGACAGT ATGAGCAGAAGACAGACTTTTTATTCTAACAATCGAAGCCCAACAAACAGTACGGGTATG TGGAAGGACTCGCCTAAATCTTCCAAGTCCATCAAATTCATTCCTGTTTCAACTTGA
- Chromosome Location
- 12
- Locus
- 12q14-q15
- External Identifiers
Resource Link UniProtKB ID P37288 UniProtKB Entry Name V1AR_HUMAN GenBank Protein ID 667068 GenBank Gene ID L25615 GenAtlas ID AVPR1A HGNC ID HGNC:895 - General References
- Thibonnier M, Auzan C, Madhun Z, Wilkins P, Berti-Mattera L, Clauser E: Molecular cloning, sequencing, and functional expression of a cDNA encoding the human V1a vasopressin receptor. J Biol Chem. 1994 Feb 4;269(5):3304-10. [Article]
- Hirasawa A, Shibata K, Kotosai K, Tsujimoto G: Cloning, functional expression and tissue distribution of human cDNA for the vascular-type vasopressin receptor. Biochem Biophys Res Commun. 1994 Aug 30;203(1):72-9. [Article]
- North WG, Fay MJ, Longo K, Du J: Functional vasopressin V1 type receptors are present in variant as well as classical forms of small-cell carcinoma. Peptides. 1997;18(7):985-93. [Article]
- North WG, Fay MJ, Longo KA, Du J: Expression of all known vasopressin receptor subtypes by small cell tumors implies a multifaceted role for this neuropeptide. Cancer Res. 1998 May 1;58(9):1866-71. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Kim SJ, Young LJ, Gonen D, Veenstra-VanderWeele J, Courchesne R, Courchesne E, Lord C, Leventhal BL, Cook EH Jr, Insel TR: Transmission disequilibrium testing of arginine vasopressin receptor 1A (AVPR1A) polymorphisms in autism. Mol Psychiatry. 2002;7(5):503-7. [Article]
- Adikesavan NV, Mahmood SS, Stanley N, Xu Z, Wu N, Thibonnier M, Shoham M: A C-terminal segment of the V1R vasopressin receptor is unstructured in the crystal structure of its chimera with the maltose-binding protein. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2005 Apr 1;61(Pt 4):341-5. Epub 2005 Mar 24. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00067 Vasopressin approved yes agonistregulator Details DB00093 Felypressin experimental yes agonist Details DB00872 Conivaptan approved, investigational yes antagonist Details DB02638 Terlipressin approved, investigational yes agonist Details DB00035 Desmopressin approved yes Details DB05452 PH-284 investigational unknown Details DB06212 Tolvaptan approved no antagonist Details DB13929 Relcovaptan investigational unknown antagonist Details DB09059 Atosiban approved, investigational unknown antagonist Details DB14642 Lypressin approved yes Details DB16279 Pecavaptan investigational unknown antagonist Details