Plasmepsin-2
Details
- Name
- Plasmepsin-2
- Synonyms
- 3.4.23.39
- Aspartic hemoglobinase II
- PFAPD
- Gene Name
- Not Available
- Organism
- Plasmodium falciparum
- Amino acid sequence
>lcl|BSEQ0003359|Plasmepsin-2 MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH LYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEER FYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDV IKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPV PTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL
- Number of residues
- 453
- Molecular Weight
- 51489.41
- Theoretical pI
- 5.43
- GO Classification
- Functionsaspartic-type endopeptidase activityComponentsvacuole
- General Function
- Aspartic-type endopeptidase activity
- Specific Function
- Not Available
- Pfam Domain Function
- Asp (PF00026)
- Transmembrane Regions
- Not Available
- Cellular Location
- Vacuole
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P46925 UniProtKB Entry Name PLM2_PLAFA GenBank Protein ID 858754 GenBank Gene ID L10740 - General References
- Dame JB, Reddy GR, Yowell CA, Dunn BM, Kay J, Berry C: Sequence, expression and modeled structure of an aspartic proteinase from the human malaria parasite Plasmodium falciparum. Mol Biochem Parasitol. 1994 Apr;64(2):177-90. [Article]
- Silva AM, Lee AY, Gulnik SV, Maier P, Collins J, Bhat TN, Collins PJ, Cachau RE, Luker KE, Gluzman IY, Francis SE, Oksman A, Goldberg DE, Erickson JW: Structure and inhibition of plasmepsin II, a hemoglobin-degrading enzyme from Plasmodium falciparum. Proc Natl Acad Sci U S A. 1996 Sep 17;93(19):10034-9. [Article]
- Bernstein NK, Cherney MM, Loetscher H, Ridley RG, James MN: Crystal structure of the novel aspartic proteinase zymogen proplasmepsin II from plasmodium falciparum. Nat Struct Biol. 1999 Jan;6(1):32-7. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB02505 N-(R-Carboxy-Ethyl)-Alpha-(S)-(2-Phenylethyl) experimental unknown Details DB03063 N-[(2S,3S)-4-[2-[(5S)-3a,4,5,6,7,7a-Hexahydro-1,3-benzodioxol-5-yl]ethyl-[3-(1,3-dioxoisoindol-2-yl)propanoyl]amino]-3-hydroxy-1-phenylbutan-2-yl]-3,5-dimethoxy-4-phenylmethoxybenzamide experimental unknown Details DB04373 4-Amino-N-{4-[2-(2,6-Dimethyl-Phenoxy)-Acetylamino]-3-Hydroxy-1-Isobutyl-5-Phenyl-Pentyl}-Benzamide experimental unknown Details DB04378 3-Amino-N-{4-[2-(2,6-Dimethyl-Phenoxy)-Acetylamino]-3-Hydroxy-1-Isobutyl-5-Phenyl-Pentyl}-Benzamide experimental unknown Details DB01218 Halofantrine approved unknown inhibitor Details DB11638 Artenimol approved, experimental, investigational unknown ligand Details