C-C chemokine receptor type 5
Details
- Name
- C-C chemokine receptor type 5
- Synonyms
- C-C CKR-5
- CHEMR13
- CMKBR5
- HIV-1 fusion coreceptor
- Gene Name
- CCR5
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0016246|C-C chemokine receptor type 5 MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
- Number of residues
- 352
- Molecular Weight
- 40523.645
- Theoretical pI
- 9.18
- GO Classification
- Functionsactin binding / C-C chemokine binding / C-C chemokine receptor activity / chemokine (C-C motif) ligand 5 binding / chemokine receptor activity / coreceptor activity / phosphatidylinositol phospholipase C activity / virus receptor activityProcessescalcium ion transport / calcium-mediated signaling / cell surface receptor signaling pathway / cell-cell signaling / cellular defense response / cellular response to lipopolysaccharide / chemokine-mediated signaling pathway / chemotaxis / dendritic cell chemotaxis / entry into host cell / G-protein coupled receptor signaling pathway / immune response / inflammatory response / MAPK cascade / positive regulation of cytosolic calcium ion concentration / release of sequestered calcium ion into cytosol by sarcoplasmic reticulum / response to cholesterol / signaling / viral processComponentscell surface / cytoplasm / cytosol / endosome / external side of plasma membrane / integral component of plasma membrane / plasma membrane
- General Function
- Virus receptor activity
- Specific Function
- Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 R5 isolates.(Microbial infection) Acts as a receptor for human immunodeficiency virus-1/HIV-1.
- Pfam Domain Function
- 7tm_1 (PF00001)
- Transmembrane Regions
- 31-58 69-89 103-124 142-166 199-218 236-260 278-301
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0016247|C-C chemokine receptor type 5 (CCR5) ATGGATTATCAAGTGTCAAGTCCAATCTATGACATCAATTATTATACATCGGAGCCCTGC CAAAAAATCAATGTGAAGCAAATCGCAGCCCGCCTCCTGCCTCCGCTCTACTCACTGGTG TTCATCTTTGGTTTTGTGGGCAACATGCTGGTCATCCTCATCCTGATAAACTGCAAAAGG CTGAAGAGCATGACTGACATCTACCTGCTCAACCTGGCCATCTCTGACCTGTTTTTCCTT CTTACTGTCCCCTTCTGGGCTCACTATGCTGCCGCCCAGTGGGACTTTGGAAATACAATG TGTCAACTCTTGACAGGGCTCTATTTTATAGGCTTCTTCTCTGGAATCTTCTTCATCATC CTCCTGACAATCGATAGGTACCTGGCTGTCGTCCATGCTGTGTTTGCTTTAAAAGCCAGG ACGGTCACCTTTGGGGTGGTGACAAGTGTGATCACTTGGGTGGTGGCTGTGTTTGCGTCT CTCCCAGGAATCATCTTTACCAGATCTCAAAAAGAAGGTCTTCATTACACCTGCAGCTCT CATTTTCCATACAGTCAGTATCAATTCTGGAAGAATTTCCAGACATTAAAGATAGTCATC TTGGGGCTGGTCCTGCCGCTGCTTGTCATGGTCATCTGCTACTCGGGAATCCTAAAAACT CTGCTTCGGTGTCGAAATGAGAAGAAGAGGCACAGGGCTGTGAGGCTTATCTTCACCATC ATGATTGTTTATTTTCTCTTCTGGGCTCCCTACAACATTGTCCTTCTCCTGAACACCTTC CAGGAATTCTTTGGCCTGAATAATTGCAGTAGCTCTAACAGGTTGGACCAAGCTATGCAG GTGACAGAGACTCTTGGGATGACGCACTGCTGCATCAACCCCATCATCTATGCCTTTGTC GGGGAGAAGTTCAGAAACTACCTCTTAGTCTTCTTCCAAAAGCACATTGCCAAACGCTTC TGCAAATGCTGTTCTATTTTCCAGCAAGAGGCTCCCGAGCGAGCAAGCTCAGTTTACACC CGATCCACTGGGGAGCAGGAAATATCTGTGGGCTTGTGA
- Chromosome Location
- 3
- Locus
- 3p21.31
- External Identifiers
Resource Link UniProtKB ID P51681 UniProtKB Entry Name CCR5_HUMAN GenBank Protein ID 1262811 GenBank Gene ID X91492 GenAtlas ID CCR5 HGNC ID HGNC:1606 - General References
- Samson M, Labbe O, Mollereau C, Vassart G, Parmentier M: Molecular cloning and functional expression of a new human CC-chemokine receptor gene. Biochemistry. 1996 Mar 19;35(11):3362-7. [Article]
- Raport CJ, Gosling J, Schweickart VL, Gray PW, Charo IF: Molecular cloning and functional characterization of a novel human CC chemokine receptor (CCR5) for RANTES, MIP-1beta, and MIP-1alpha. J Biol Chem. 1996 Jul 19;271(29):17161-6. [Article]
- Combadiere C, Ahuja SK, Tiffany HL, Murphy PM: Cloning and functional expression of CC CKR5, a human monocyte CC chemokine receptor selective for MIP-1(alpha), MIP-1(beta), and RANTES. J Leukoc Biol. 1996 Jul;60(1):147-52. [Article]
- Kuhmann SE, Platt EJ, Kozak SL, Kabat D: Polymorphisms in the CCR5 genes of African green monkeys and mice implicate specific amino acids in infections by simian and human immunodeficiency viruses. J Virol. 1997 Nov;71(11):8642-56. [Article]
- Zhang L, Carruthers CD, He T, Huang Y, Cao Y, Wang G, Hahn B, Ho DD: HIV type 1 subtypes, coreceptor usage, and CCR5 polymorphism. AIDS Res Hum Retroviruses. 1997 Nov 1;13(16):1357-66. [Article]
- Mummidi S, Ahuja SS, McDaniel BL, Ahuja SK: The human CC chemokine receptor 5 (CCR5) gene. Multiple transcripts with 5'-end heterogeneity, dual promoter usage, and evidence for polymorphisms within the regulatory regions and noncoding exons. J Biol Chem. 1997 Dec 5;272(49):30662-71. [Article]
- Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Liu R, Paxton WA, Choe S, Ceradini D, Martin SR, Horuk R, MacDonald ME, Stuhlmann H, Koup RA, Landau NR: Homozygous defect in HIV-1 coreceptor accounts for resistance of some multiply-exposed individuals to HIV-1 infection. Cell. 1996 Aug 9;86(3):367-77. [Article]
- Deng H, Liu R, Ellmeier W, Choe S, Unutmaz D, Burkhart M, Di Marzio P, Marmon S, Sutton RE, Hill CM, Davis CB, Peiper SC, Schall TJ, Littman DR, Landau NR: Identification of a major co-receptor for primary isolates of HIV-1. Nature. 1996 Jun 20;381(6584):661-6. [Article]
- Dragic T, Litwin V, Allaway GP, Martin SR, Huang Y, Nagashima KA, Cayanan C, Maddon PJ, Koup RA, Moore JP, Paxton WA: HIV-1 entry into CD4+ cells is mediated by the chemokine receptor CC-CKR-5. Nature. 1996 Jun 20;381(6584):667-73. [Article]
- Samson M, Libert F, Doranz BJ, Rucker J, Liesnard C, Farber CM, Saragosti S, Lapoumeroulie C, Cognaux J, Forceille C, Muyldermans G, Verhofstede C, Burtonboy G, Georges M, Imai T, Rana S, Yi Y, Smyth RJ, Collman RG, Doms RW, Vassart G, Parmentier M: Resistance to HIV-1 infection in caucasian individuals bearing mutant alleles of the CCR-5 chemokine receptor gene. Nature. 1996 Aug 22;382(6593):722-5. [Article]
- Rizzuto CD, Wyatt R, Hernandez-Ramos N, Sun Y, Kwong PD, Hendrickson WA, Sodroski J: A conserved HIV gp120 glycoprotein structure involved in chemokine receptor binding. Science. 1998 Jun 19;280(5371):1949-53. [Article]
- Farzan M, Mirzabekov T, Kolchinsky P, Wyatt R, Cayabyab M, Gerard NP, Gerard C, Sodroski J, Choe H: Tyrosine sulfation of the amino terminus of CCR5 facilitates HIV-1 entry. Cell. 1999 Mar 5;96(5):667-76. [Article]
- Oppermann M, Mack M, Proudfoot AE, Olbrich H: Differential effects of CC chemokines on CC chemokine receptor 5 (CCR5) phosphorylation and identification of phosphorylation sites on the CCR5 carboxyl terminus. J Biol Chem. 1999 Mar 26;274(13):8875-85. [Article]
- Blanpain C, Wittamer V, Vanderwinden JM, Boom A, Renneboog B, Lee B, Le Poul E, El Asmar L, Govaerts C, Vassart G, Doms RW, Parmentier M: Palmitoylation of CCR5 is critical for receptor trafficking and efficient activation of intracellular signaling pathways. J Biol Chem. 2001 Jun 29;276(26):23795-804. Epub 2001 Apr 25. [Article]
- Kraft K, Olbrich H, Majoul I, Mack M, Proudfoot A, Oppermann M: Characterization of sequence determinants within the carboxyl-terminal domain of chemokine receptor CCR5 that regulate signaling and receptor internalization. J Biol Chem. 2001 Sep 14;276(37):34408-18. Epub 2001 Jul 11. [Article]
- Bannert N, Craig S, Farzan M, Sogah D, Santo NV, Choe H, Sodroski J: Sialylated O-glycans and sulfated tyrosines in the NH2-terminal domain of CC chemokine receptor 5 contribute to high affinity binding of chemokines. J Exp Med. 2001 Dec 3;194(11):1661-73. [Article]
- Schweneker M, Bachmann AS, Moelling K: JM4 is a four-transmembrane protein binding to the CCR5 receptor. FEBS Lett. 2005 Mar 14;579(7):1751-8. [Article]
- Huttenrauch F, Pollok-Kopp B, Oppermann M: G protein-coupled receptor kinases promote phosphorylation and beta-arrestin-mediated internalization of CCR5 homo- and hetero-oligomers. J Biol Chem. 2005 Nov 11;280(45):37503-15. Epub 2005 Sep 6. [Article]
- Glass WG, McDermott DH, Lim JK, Lekhong S, Yu SF, Frank WA, Pape J, Cheshier RC, Murphy PM: CCR5 deficiency increases risk of symptomatic West Nile virus infection. J Exp Med. 2006 Jan 23;203(1):35-40. Epub 2006 Jan 17. [Article]
- Tadagaki K, Tudor D, Gbahou F, Tschische P, Waldhoer M, Bomsel M, Jockers R, Kamal M: Human cytomegalovirus-encoded UL33 and UL78 heteromerize with host CCR5 and CXCR4 impairing their HIV coreceptor activity. Blood. 2012 May 24;119(21):4908-18. doi: 10.1182/blood-2011-08-372516. Epub 2012 Apr 10. [Article]
- Paterlini MG: Structure modeling of the chemokine receptor CCR5: implications for ligand binding and selectivity. Biophys J. 2002 Dec;83(6):3012-31. [Article]
- Liu S, Fan S, Sun Z: Structural and functional characterization of the human CCR5 receptor in complex with HIV gp120 envelope glycoprotein and CD4 receptor by molecular modeling studies. J Mol Model. 2003 Oct;9(5):329-36. Epub 2003 Aug 29. [Article]
- Schnur E, Noah E, Ayzenshtat I, Sargsyan H, Inui T, Ding FX, Arshava B, Sagi Y, Kessler N, Levy R, Scherf T, Naider F, Anglister J: The conformation and orientation of a 27-residue CCR5 peptide in a ternary complex with HIV-1 gp120 and a CD4-mimic peptide. J Mol Biol. 2011 Jul 29;410(5):778-97. doi: 10.1016/j.jmb.2011.04.023. [Article]
- Ansari-Lari MA, Liu XM, Metzker ML, Rut AR, Gibbs RA: The extent of genetic variation in the CCR5 gene. Nat Genet. 1997 Jul;16(3):221-2. [Article]
- Carrington M, Kissner T, Gerrard B, Ivanov S, O'Brien SJ, Dean M: Novel alleles of the chemokine-receptor gene CCR5. Am J Hum Genet. 1997 Dec;61(6):1261-7. [Article]
- Tamasauskas D, Powell V, Saksela K, Yazdanbakhsh K: A homologous naturally occurring mutation in Duffy and CCR5 leading to reduced receptor expression. Blood. 2001 Jun 1;97(11):3651-4. [Article]
- Smyth DJ, Plagnol V, Walker NM, Cooper JD, Downes K, Yang JH, Howson JM, Stevens H, McManus R, Wijmenga C, Heap GA, Dubois PC, Clayton DG, Hunt KA, van Heel DA, Todd JA: Shared and distinct genetic variants in type 1 diabetes and celiac disease. N Engl J Med. 2008 Dec 25;359(26):2767-77. doi: 10.1056/NEJMoa0807917. Epub 2008 Dec 10. [Article]
- Sauvageau E, Rochdi MD, Oueslati M, Hamdan FF, Percherancier Y, Simpson JC, Pepperkok R, Bouvier M: CNIH4 interacts with newly synthesized GPCR and controls their export from the endoplasmic reticulum. Traffic. 2014 Apr;15(4):383-400. doi: 10.1111/tra.12148. Epub 2014 Feb 6. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB04835 Maraviroc approved, investigational yes antagonistinhibitor Details DB12960 INCB-9471 investigational unknown Details DB05941 Leronlimab investigational unknown antagonist Details DB06497 Aplaviroc investigational unknown antagonist Details DB06652 Vicriviroc investigational unknown antagonist Details DB12698 Ibalizumab approved, investigational unknown antagonist Details DB05906 CCR5 mAb investigational unknown Details