Ras-related protein Rab-11A
Details
- Name
- Ras-related protein Rab-11A
- Synonyms
- Rab-11
- RAB11
- YL8
- Gene Name
- RAB11A
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0009479|Ras-related protein Rab-11A MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
- Number of residues
- 216
- Molecular Weight
- 24393.305
- Theoretical pI
- Not Available
- GO Classification
- FunctionsGTP binding / GTPase activity / microtubule binding / myosin V binding / syntaxin bindingProcessesastral microtubule organization / cytokinesis / establishment of protein localization to membrane / establishment of protein localization to organelle / establishment of vesicle localization / exosomal secretion / intracellular protein transport / melanosome transport / mitotic metaphase plate congression / mitotic spindle assembly / multivesicular body assembly / neuron projection development / organelle organization / plasma membrane to endosome transport / positive regulation of axon extension / positive regulation of epithelial cell migration / positive regulation of G2/M transition of mitotic cell cycle / protein localization to plasma membrane / Rab protein signal transduction / regulation of long-term neuronal synaptic plasticity / regulation of multivesicular body size / regulation of protein transport / regulation of vesicle-mediated transport / renal water homeostasis / transmembrane transport / vesicle-mediated transport / water transportComponentsaxon / cleavage furrow / cytoplasmic vesicle / cytoplasmic vesicle membrane / cytosol / extracellular exosome / Golgi apparatus / mitochondrion / multivesicular body / perinuclear region of cytoplasm / phagocytic vesicle / phagocytic vesicle membrane / plasma membrane / protein complex / recycling endosome / recycling endosome membrane / spindle pole / trans-Golgi network / transport vesicle / vesicle
- General Function
- Syntaxin binding
- Specific Function
- The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab regulates endocytic recycling. Acts as a major regulator of membrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma membrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma membrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral membranes. May also play a role in melanosome transport and release from melanocytes.
- Pfam Domain Function
- Ras (PF00071)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0021867|Ras-related protein Rab-11A (RAB11A) ATGGGCACCCGCGACGACGAGTACGACTACCTCTTTAAAGTTGTCCTTATTGGAGATTCT GGTGTTGGAAAGAGTAATCTCCTGTCTCGATTTACTCGAAATGAGTTTAATCTGGAAAGC AAGAGCACCATTGGAGTAGAGTTTGCAACAAGAAGCATCCAGGTTGATGGAAAAACAATA AAGGCACAGATATGGGACACAGCAGGGCAAGAGCGATATCGAGCTATAACATCAGCATAT TATCGTGGAGCTGTAGGTGCCTTATTGGTTTATGACATTGCTAAACATCTCACATATGAA AATGTAGAGCGATGGCTGAAAGAACTGAGAGATCATGCTGATAGTAACATTGTTATCATG CTTGTGGGCAATAAGAGTGATCTACGTCATCTCAGGGCAGTTCCTACAGATGAAGCAAGA GCTTTTGCAGAAAAGAATGAAGCAAATGTCAGACAGACGCGAAAATGA
- Chromosome Location
- 15
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P62491 UniProtKB Entry Name RB11A_HUMAN HGNC ID HGNC:9760 - General References
- Drivas GT, Shih A, Coutavas EE, D'Eustachio P, Rush MG: Identification and characterization of a human homolog of the Schizosaccharomyces pombe ras-like gene YPT-3. Oncogene. 1991 Jan;6(1):3-9. [Article]
- Gromov PS, Celis JE, Hansen C, Tommerup N, Gromova I, Madsen P: Human rab11a: transcription, chromosome mapping and effect on the expression levels of host GTP-binding proteins. FEBS Lett. 1998 Jun 16;429(3):359-64. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Hales CM, Griner R, Hobdy-Henderson KC, Dorn MC, Hardy D, Kumar R, Navarre J, Chan EK, Lapierre LA, Goldenring JR: Identification and characterization of a family of Rab11-interacting proteins. J Biol Chem. 2001 Oct 19;276(42):39067-75. Epub 2001 Aug 8. [Article]
- Wallace DM, Lindsay AJ, Hendrick AG, McCaffrey MW: Rab11-FIP4 interacts with Rab11 in a GTP-dependent manner and its overexpression condenses the Rab11 positive compartment in HeLa cells. Biochem Biophys Res Commun. 2002 Dec 20;299(5):770-9. [Article]
- Lindsay AJ, Hendrick AG, Cantalupo G, Senic-Matuglia F, Goud B, Bucci C, McCaffrey MW: Rab coupling protein (RCP), a novel Rab4 and Rab11 effector protein. J Biol Chem. 2002 Apr 5;277(14):12190-9. Epub 2002 Jan 10. [Article]
- Lindsay AJ, McCaffrey MW: Rab11-FIP2 functions in transferrin recycling and associates with endosomal membranes via its COOH-terminal domain. J Biol Chem. 2002 Jul 26;277(30):27193-9. Epub 2002 May 6. [Article]
- Lindsay AJ, McCaffrey MW: Characterisation of the Rab binding properties of Rab coupling protein (RCP) by site-directed mutagenesis. FEBS Lett. 2004 Jul 30;571(1-3):86-92. [Article]
- Junutula JR, Schonteich E, Wilson GM, Peden AA, Scheller RH, Prekeris R: Molecular characterization of Rab11 interactions with members of the family of Rab11-interacting proteins. J Biol Chem. 2004 Aug 6;279(32):33430-7. Epub 2004 Jun 1. [Article]
- Lindsay AJ, McCaffrey MW: The C2 domains of the class I Rab11 family of interacting proteins target recycling vesicles to the plasma membrane. J Cell Sci. 2004 Sep 1;117(Pt 19):4365-75. Epub 2004 Aug 10. [Article]
- Peden AA, Schonteich E, Chun J, Junutula JR, Scheller RH, Prekeris R: The RCP-Rab11 complex regulates endocytic protein sorting. Mol Biol Cell. 2004 Aug;15(8):3530-41. Epub 2004 Jun 4. [Article]
- Fielding AB, Schonteich E, Matheson J, Wilson G, Yu X, Hickson GR, Srivastava S, Baldwin SA, Prekeris R, Gould GW: Rab11-FIP3 and FIP4 interact with Arf6 and the exocyst to control membrane traffic in cytokinesis. EMBO J. 2005 Oct 5;24(19):3389-99. Epub 2005 Sep 8. [Article]
- Wilson GM, Fielding AB, Simon GC, Yu X, Andrews PD, Hames RS, Frey AM, Peden AA, Gould GW, Prekeris R: The FIP3-Rab11 protein complex regulates recycling endosome targeting to the cleavage furrow during late cytokinesis. Mol Biol Cell. 2005 Feb;16(2):849-60. Epub 2004 Dec 15. [Article]
- Lock JG, Stow JL: Rab11 in recycling endosomes regulates the sorting and basolateral transport of E-cadherin. Mol Biol Cell. 2005 Apr;16(4):1744-55. Epub 2005 Feb 2. [Article]
- Shirane M, Nakayama KI: Protrudin induces neurite formation by directional membrane trafficking. Science. 2006 Nov 3;314(5800):818-21. [Article]
- Swiatecka-Urban A, Talebian L, Kanno E, Moreau-Marquis S, Coutermarsh B, Hansen K, Karlson KH, Barnaby R, Cheney RE, Langford GM, Fukuda M, Stanton BA: Myosin Vb is required for trafficking of the cystic fibrosis transmembrane conductance regulator in Rab11a-specific apical recycling endosomes in polarized human airway epithelial cells. J Biol Chem. 2007 Aug 10;282(32):23725-36. Epub 2007 Apr 26. [Article]
- Westlake CJ, Junutula JR, Simon GC, Pilli M, Prekeris R, Scheller RH, Jackson PK, Eldridge AG: Identification of Rab11 as a small GTPase binding protein for the Evi5 oncogene. Proc Natl Acad Sci U S A. 2007 Jan 23;104(4):1236-41. Epub 2007 Jan 17. [Article]
- Pohl C, Jentsch S: Final stages of cytokinesis and midbody ring formation are controlled by BRUCE. Cell. 2008 Mar 7;132(5):832-45. doi: 10.1016/j.cell.2008.01.012. [Article]
- Chu BB, Ge L, Xie C, Zhao Y, Miao HH, Wang J, Li BL, Song BL: Requirement of myosin Vb.Rab11a.Rab11-FIP2 complex in cholesterol-regulated translocation of NPC1L1 to the cell surface. J Biol Chem. 2009 Aug 14;284(33):22481-90. doi: 10.1074/jbc.M109.034355. Epub 2009 Jun 19. [Article]
- Bryant DM, Datta A, Rodriguez-Fraticelli AE, Peranen J, Martin-Belmonte F, Mostov KE: A molecular network for de novo generation of the apical surface and lumen. Nat Cell Biol. 2010 Nov;12(11):1035-45. doi: 10.1038/ncb2106. Epub 2010 Oct 3. [Article]
- Cullinane AR, Straatman-Iwanowska A, Zaucker A, Wakabayashi Y, Bruce CK, Luo G, Rahman F, Gurakan F, Utine E, Ozkan TB, Denecke J, Vukovic J, Di Rocco M, Mandel H, Cangul H, Matthews RP, Thomas SG, Rappoport JZ, Arias IM, Wolburg H, Knisely AS, Kelly DA, Muller F, Maher ER, Gissen P: Mutations in VIPAR cause an arthrogryposis, renal dysfunction and cholestasis syndrome phenotype with defects in epithelial polarization. Nat Genet. 2010 Apr;42(4):303-12. doi: 10.1038/ng.538. Epub 2010 Feb 28. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Roland JT, Bryant DM, Datta A, Itzen A, Mostov KE, Goldenring JR: Rab GTPase-Myo5B complexes control membrane recycling and epithelial polarization. Proc Natl Acad Sci U S A. 2011 Feb 15;108(7):2789-94. doi: 10.1073/pnas.1010754108. Epub 2011 Jan 31. [Article]
- Seto S, Tsujimura K, Koide Y: Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes. Traffic. 2011 Apr;12(4):407-20. doi: 10.1111/j.1600-0854.2011.01165.x. Epub 2011 Feb 21. [Article]
- Longatti A, Lamb CA, Razi M, Yoshimura S, Barr FA, Tooze SA: TBC1D14 regulates autophagosome formation via Rab11- and ULK1-positive recycling endosomes. J Cell Biol. 2012 May 28;197(5):659-75. doi: 10.1083/jcb.201111079. Epub 2012 May 21. [Article]
- Lee Y, Chung S, Baek IK, Lee TH, Paik SY, Lee J: UNC119a bridges the transmission of Fyn signals to Rab11, leading to the completion of cytokinesis. Cell Cycle. 2013 Apr 15;12(8):1303-15. doi: 10.4161/cc.24404. Epub 2013 Mar 27. [Article]
- Catherman AD, Durbin KR, Ahlf DR, Early BP, Fellers RT, Tran JC, Thomas PM, Kelleher NL: Large-scale top-down proteomics of the human proteome: membrane proteins, mitochondria, and senescence. Mol Cell Proteomics. 2013 Dec;12(12):3465-73. doi: 10.1074/mcp.M113.030114. Epub 2013 Sep 10. [Article]
- Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]
- Eathiraj S, Pan X, Ritacco C, Lambright DG: Structural basis of family-wide Rab GTPase recognition by rabenosyn-5. Nature. 2005 Jul 21;436(7049):415-9. [Article]
- Pasqualato S, Cherfils J: Crystallographic evidence for substrate-assisted GTP hydrolysis by a small GTP binding protein. Structure. 2005 Apr;13(4):533-40. [Article]
- Eathiraj S, Mishra A, Prekeris R, Lambright DG: Structural basis for Rab11-mediated recruitment of FIP3 to recycling endosomes. J Mol Biol. 2006 Nov 24;364(2):121-35. Epub 2006 Aug 26. [Article]
- Shiba T, Koga H, Shin HW, Kawasaki M, Kato R, Nakayama K, Wakatsuki S: Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proc Natl Acad Sci U S A. 2006 Oct 17;103(42):15416-21. Epub 2006 Oct 9. [Article]
- Jagoe WN, Lindsay AJ, Read RJ, McCoy AJ, McCaffrey MW, Khan AR: Crystal structure of rab11 in complex with rab11 family interacting protein 2. Structure. 2006 Aug;14(8):1273-83. [Article]