Divalent-cation tolerance protein CutA
Details
- Name
- Divalent-cation tolerance protein CutA
- Synonyms
- C-type cytochrome biogenesis protein CycY
- cutA1
- cycY
- Gene Name
- cutA
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0016634|Divalent-cation tolerance protein CutA MLDEKSSNTASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEY EVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
- Number of residues
- 112
- Molecular Weight
- 12330.955
- Theoretical pI
- 4.61
- GO Classification
- Functionscopper ion binding / metal ion bindingProcessesprotein homooligomerization / response to copper ionComponentscytoplasm
- General Function
- Metal ion binding
- Specific Function
- Involved in resistance toward heavy metals.
- Pfam Domain Function
- CutA1 (PF03091)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0016635|Divalent-cation tolerance protein CutA (cutA) ATGCTTGATGAAAAAAGTTCGAATACCGCGTCTGTCGTGGTGCTATGTACGGCACCAGAT GAAGCGACAGCCCAGGATTTAGCCGCCAAAGTGCTGGCGGAAAAACTGGCGGCCTGCGCG ACCTTGATCCCCGGCGCTACCTCTCTCTATTACTGGGAAGGTAAGCTGGAGCAAGAATAC GAAGTGCAGATGATTTTAAAAACTACCGTATCTCACCAGCAGGCACTGCTGGAATGCCTG AAGTCTCATCATCCATATCAAACCCCGGAACTTCTGGTTTTACCTGTTACACACGGAGAC ACAGATTACCTCTCATGGCTCAACGCATCTTTACGCTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P69488 UniProtKB Entry Name CUTA_ECOLI GenBank Protein ID 871028 GenBank Gene ID X77707 - General References
- Crooke H, Cole J: The biogenesis of c-type cytochromes in Escherichia coli requires a membrane-bound protein, DipZ, with a protein disulphide isomerase-like domain. Mol Microbiol. 1995 Mar;15(6):1139-50. [Article]
- Fong ST, Camakaris J, Lee BT: Molecular genetics of a chromosomal locus involved in copper tolerance in Escherichia coli K-12. Mol Microbiol. 1995 Mar;15(6):1127-37. [Article]
- Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR: Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. Nucleic Acids Res. 1995 Jun 25;23(12):2105-19. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Arnesano F, Banci L, Benvenuti M, Bertini I, Calderone V, Mangani S, Viezzoli MS: The evolutionarily conserved trimeric structure of CutA1 proteins suggests a role in signal transduction. J Biol Chem. 2003 Nov 14;278(46):45999-6006. Epub 2003 Aug 29. [Article]