Cyanovirin-N
Details
- Name
- Cyanovirin-N
- Synonyms
- CV-N
- Gene Name
- Not Available
- Organism
- Nostoc ellipsosporum
- Amino acid sequence
>lcl|BSEQ0011355|Cyanovirin-N LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRN TQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE
- Number of residues
- 101
- Molecular Weight
- 11013.03
- Theoretical pI
- 4.69
- GO Classification
- Functionscarbohydrate bindingProcessesregulation of defense response to virus
- General Function
- Carbohydrate binding
- Specific Function
- Mannose-binding lectin.
- Pfam Domain Function
- CVNH (PF08881)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P81180 UniProtKB Entry Name CVN_NOSEL - General References
- Boyd MR, Gustafson KR, McMahon JB, Shoemaker RH, O'Keefe BR, Mori T, Gulakowski RJ, Wu L, Rivera MI, Laurencot CM, Currens MJ, Cardellina JH 2nd, Buckheit RW Jr, Nara PL, Pannell LK, Sowder RC 2nd, Henderson LE: Discovery of cyanovirin-N, a novel human immunodeficiency virus-inactivating protein that binds viral surface envelope glycoprotein gp120: potential applications to microbicide development. Antimicrob Agents Chemother. 1997 Jul;41(7):1521-30. [Article]
- Gustafson KR, Sowder RC 2nd, Henderson LE, Cardellina JH 2nd, McMahon JB, Rajamani U, Pannell LK, Boyd MR: Isolation, primary sequence determination, and disulfide bond structure of cyanovirin-N, an anti-HIV (human immunodeficiency virus) protein from the cyanobacterium Nostoc ellipsosporum. Biochem Biophys Res Commun. 1997 Sep 8;238(1):223-8. [Article]
- Dey B, Lerner DL, Lusso P, Boyd MR, Elder JH, Berger EA: Multiple antiviral activities of cyanovirin-N: blocking of human immunodeficiency virus type 1 gp120 interaction with CD4 and coreceptor and inhibition of diverse enveloped viruses. J Virol. 2000 May;74(10):4562-9. [Article]
- Mori T, Barrientos LG, Han Z, Gronenborn AM, Turpin JA, Boyd MR: Functional homologs of cyanovirin-N amenable to mass production in prokaryotic and eukaryotic hosts. Protein Expr Purif. 2002 Oct;26(1):42-9. [Article]
- Botos I, Wlodawer A: Cyanovirin-N: a sugar-binding antiviral protein with a new twist. Cell Mol Life Sci. 2003 Feb;60(2):277-87. [Article]
- Liu X, Lagenaur LA, Simpson DA, Essenmacher KP, Frazier-Parker CL, Liu Y, Tsai D, Rao SS, Hamer DH, Parks TP, Lee PP, Xu Q: Engineered vaginal lactobacillus strain for mucosal delivery of the human immunodeficiency virus inhibitor cyanovirin-N. Antimicrob Agents Chemother. 2006 Oct;50(10):3250-9. [Article]
- Sexton A, Drake PM, Mahmood N, Harman SJ, Shattock RJ, Ma JK: Transgenic plant production of Cyanovirin-N, an HIV microbicide. FASEB J. 2006 Feb;20(2):356-8. Epub 2005 Dec 14. [Article]
- Gao X, Chen W, Guo C, Qian C, Liu G, Ge F, Huang Y, Kitazato K, Wang Y, Xiong S: Soluble cytoplasmic expression, rapid purification, and characterization of cyanovirin-N as a His-SUMO fusion. Appl Microbiol Biotechnol. 2010 Jan;85(4):1051-60. doi: 10.1007/s00253-009-2078-5. Epub 2009 Jun 23. [Article]
- Xiong S, Fan J, Kitazato K: The antiviral protein cyanovirin-N: the current state of its production and applications. Appl Microbiol Biotechnol. 2010 Apr;86(3):805-12. doi: 10.1007/s00253-010-2470-1. Epub 2010 Feb 17. [Article]
- Bewley CA, Gustafson KR, Boyd MR, Covell DG, Bax A, Clore GM, Gronenborn AM: Solution structure of cyanovirin-N, a potent HIV-inactivating protein. Nat Struct Biol. 1998 Jul;5(7):571-8. [Article]
- Yang F, Bewley CA, Louis JM, Gustafson KR, Boyd MR, Gronenborn AM, Clore GM, Wlodawer A: Crystal structure of cyanovirin-N, a potent HIV-inactivating protein, shows unexpected domain swapping. J Mol Biol. 1999 May 7;288(3):403-12. [Article]
- Botos I, O'Keefe BR, Shenoy SR, Cartner LK, Ratner DM, Seeberger PH, Boyd MR, Wlodawer A: Structures of the complexes of a potent anti-HIV protein cyanovirin-N and high mannose oligosaccharides. J Biol Chem. 2002 Sep 13;277(37):34336-42. Epub 2002 Jul 10. [Article]
- Barrientos LG, Louis JM, Botos I, Mori T, Han Z, O'Keefe BR, Boyd MR, Wlodawer A, Gronenborn AM: The domain-swapped dimer of cyanovirin-N is in a metastable folded state: reconciliation of X-ray and NMR structures. Structure. 2002 May;10(5):673-86. [Article]