Diacylglycerol acyltransferase/mycolyltransferase Ag85C
Details
- Name
- Diacylglycerol acyltransferase/mycolyltransferase Ag85C
- Synonyms
- 2.3.1.122
- 85C
- Acyl-CoA:diacylglycerol acyltransferase
- Ag85C
- Antigen 85 complex C
- DGAT
- Fbps C
- Fibronectin-binding protein C
- mpt45
- Gene Name
- fbpC
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- Amino acid sequence
>lcl|BSEQ0051175|Diacylglycerol acyltransferase/mycolyltransferase Ag85C MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVP SASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQS SFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILA AYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQ IPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
- Number of residues
- 340
- Molecular Weight
- 36771.025
- Theoretical pI
- Not Available
- GO Classification
- Functionsdiacylglycerol O-acyltransferase activity / transferase activity, transferring acyl groups other than amino-acyl groups / trehalose O-mycolyltransferase activity / zymogen bindingProcessesglycolipid biosynthetic process / lipid transport / mycolate cell wall layer assembly / response to antibioticComponentscell wall / extracellular region
- General Function
- The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM.
- Specific Function
- Diacylglycerol o-acyltransferase activity
- Pfam Domain Function
- Esterase (PF00756)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0051176|Diacylglycerol acyltransferase/mycolyltransferase Ag85C (fbpC) ATGACGTTCTTCGAACAGGTGCGAAGGTTGCGGAGCGCAGCGACAACCCTGCCGCGCCGG CTGGCTATCGCGGCTATGGGGGCTGTCCTGGTTTACGGTCTGGTCGGTACCTTCGGCGGG CCGGCCACCGCGGGCGCATTCTCTAGGCCCGGTCTTCCAGTGGAATATCTGCAGGTGCCA TCCGCGTCGATGGGCCGCGACATCAAGGTCCAGTTCCAGGGCGGCGGACCGCACGCGGTC TACCTGCTCGACGGTCTGCGGGCCCAGGATGACTACAACGGCTGGGACATCAACACCCCG GCCTTCGAGGAGTACTACCAGTCAGGGTTGTCGGTGATCATGCCCGTGGGCGGCCAATCC AGTTTCTACACCGACTGGTATCAGCCCTCGCAGAGCAACGGCCAGAACTACACCTACAAG TGGGAGACCTTCCTTACCAGAGAGATGCCCGCCTGGCTACAGGCCAACAAGGGCGTGTCC CCGACAGGCAACGCGGCGGTGGGTCTTTCGATGTCGGGCGGTTCCGCGCTGATCCTGGCC GCGTACTACCCGCAGCAGTTCCCGTACGCCGCGTCGTTGTCGGGCTTCCTCAACCCGTCC GAGGGCTGGTGGCCGACGCTGATCGGCCTGGCGATGAACGACTCGGGCGGTTACAACGCC AACAGCATGTGGGGTCCGTCCAGCGACCCGGCCTGGAAGCGCAACGACCCAATGGTTCAG ATTCCCCGCCTGGTCGCCAACAACACCCGGATCTGGGTGTACTGCGGTAACGGCACACCC AGCGACCTCGGCGGCGACAACATACCGGCGAAGTTCCTGGAAGGCCTCACCCTGCGCACC AACCAGACCTTCCGGGACACCTACGCGGCCGACGGTGGACGCAACGGGGTGTTTAACTTC CCGCCCAACGGAACACACTCGTGGCCCTACTGGAACGAGCAGCTGGTCGCCATGAAGGCC GATATCCAGCATGTGCTCAACGGCGCGACACCCCCGGCCGCCCCTGCTGCGCCGGCCGCC TGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WQN9 UniProtKB Entry Name A85C_MYCTU - General References
- Content J, de la Cuvellerie A, De Wit L, Vincent-Levy-Frebault V, Ooms J, De Bruyn J: The genes coding for the antigen 85 complexes of Mycobacterium tuberculosis and Mycobacterium bovis BCG are members of a gene family: cloning, sequence determination, and genomic organization of the gene coding for antigen 85-C of M. tuberculosis. Infect Immun. 1991 Sep;59(9):3205-12. [Article]
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Wiker HG, Sletten K, Nagai S, Harboe M: Evidence for three separate genes encoding the proteins of the mycobacterial antigen 85 complex. Infect Immun. 1990 Jan;58(1):272-4. [Article]
- Abou-Zeid C, Garbe T, Lathigra R, Wiker HG, Harboe M, Rook GA, Young DB: Genetic and immunological analysis of Mycobacterium tuberculosis fibronectin-binding proteins. Infect Immun. 1991 Aug;59(8):2712-8. [Article]
- Belisle JT, Vissa VD, Sievert T, Takayama K, Brennan PJ, Besra GS: Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science. 1997 May 30;276(5317):1420-2. [Article]
- Jackson M, Raynaud C, Laneelle MA, Guilhot C, Laurent-Winter C, Ensergueix D, Gicquel B, Daffe M: Inactivation of the antigen 85C gene profoundly affects the mycolate content and alters the permeability of the Mycobacterium tuberculosis cell envelope. Mol Microbiol. 1999 Mar;31(5):1573-87. [Article]
- Raman K, Yeturu K, Chandra N: targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis. BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109. [Article]
- Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [Article]
- Ronning DR, Klabunde T, Besra GS, Vissa VD, Belisle JT, Sacchettini JC: Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat Struct Biol. 2000 Feb;7(2):141-6. [Article]
- Ronning DR, Vissa V, Besra GS, Belisle JT, Sacchettini JC: Mycobacterium tuberculosis antigen 85A and 85C structures confirm binding orientation and conserved substrate specificity. J Biol Chem. 2004 Aug 27;279(35):36771-7. Epub 2004 Jun 10. [Article]
- Sanki AK, Boucau J, Umesiri FE, Ronning DR, Sucheck SJ: Design, synthesis and biological evaluation of sugar-derived esters, alpha-ketoesters and alpha-ketoamides as inhibitors for Mycobacterium tuberculosis antigen 85C. Mol Biosyst. 2009 Sep;5(9):945-56. doi: 10.1039/b902284h. Epub 2009 Jun 19. [Article]