Interferon-stimulated gene 20 kDa protein
Details
- Name
- Interferon-stimulated gene 20 kDa protein
- Synonyms
- 3.1.13.1
- Estrogen-regulated transcript 45 protein
- HEM45
- Promyelocytic leukemia nuclear body-associated protein ISG20
- Gene Name
- ISG20
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0003839|Interferon-stimulated gene 20 kDa protein MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVT PQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREA KLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVS D
- Number of residues
- 181
- Molecular Weight
- 20363.29
- Theoretical pI
- 9.19
- GO Classification
- Functions3'-5'-exoribonuclease activity / exonuclease activity / exoribonuclease II activity / metal ion binding / single-stranded DNA 3'-5' exodeoxyribonuclease activity / U1 snRNA binding / U2 snRNA binding / U3 snoRNA bindingProcessescell proliferation / cytokine-mediated signaling pathway / defense response to virus / DNA catabolic process, exonucleolytic / negative regulation of viral genome replication / response to virus / RNA catabolic process / RNA phosphodiester bond hydrolysis, exonucleolytic / rRNA processing / type I interferon signaling pathwayComponentsCajal body / cytoplasm / nucleolus / nucleoplasm / nucleus / PML body
- General Function
- U3 snorna binding
- Specific Function
- Interferon-induced antiviral exoribonuclease that acts on single-stranded RNA and also has minor activity towards single-stranded DNA. Exhibits antiviral activity against RNA viruses including hepatitis C virus (HCV), hepatitis A virus (HAV) and yellow fever virus (YFV) in an exonuclease-dependent manner. May also play additional roles in the maturation of snRNAs and rRNAs, and in ribosome biogenesis.
- Pfam Domain Function
- RNase_T (PF00929)
- Transmembrane Regions
- Not Available
- Cellular Location
- Nucleus
- Gene sequence
>lcl|BSEQ0020570|Interferon-stimulated gene 20 kDa protein (ISG20) ATGGCTGGGAGCCGTGAGGTGGTGGCCATGGACTGCGAGATGGTGGGGCTGGGGCCCCAC CGGGAGAGTGGCCTGGCTCGTTGCAGCCTCGTGAACGTCCACGGTGCTGTGCTGTACGAC AAGTTCATCCGGCCTGAGGGAGAGATCACCGATTACAGAACCCGGGTCAGCGGGGTCACC CCTCAGCACATGGTGGGGGCCACACCATTTGCCGTGGCCAGGCTAGAGATCCTGCAGCTC CTGAAAGGCAAGCTGGTGGTGGGTCATGACCTGAAGCACGACTTCCAGGCACTGAAAGAG GACATGAGCGGCTACACAATCTACGACACGTCCACTGACAGGCTGTTGTGGCGTGAGGCC AAGCTGGACCACTGCAGGCGTGTCTCCCTGCGGGTGCTGAGTGAGCGCCTCCTACACAAG AGCATCCAGAACAGCCTGCTTGGACACAGCTCGGTGGAAGATGCGAGGGCAACGATGGAG CTCTATCAAATCTCCCAGAGAATCCGAGCCCGCCGAGGGCTGCCCCGCCTGGCTGTGTCA GACTGA
- Chromosome Location
- 15
- Locus
- 15q26
- External Identifiers
Resource Link UniProtKB ID Q96AZ6 UniProtKB Entry Name ISG20_HUMAN GenBank Protein ID 6759541 GenBank Gene ID X89773 GenAtlas ID ISG20 HGNC ID HGNC:6130 - General References
- Gongora C, David G, Pintard L, Tissot C, Hua TD, Dejean A, Mechti N: Molecular cloning of a new interferon-induced PML nuclear body-associated protein. J Biol Chem. 1997 Aug 1;272(31):19457-63. [Article]
- Pentecost BT: Expression and estrogen regulation of the HEM45 MRNA in human tumor lines and in the rat uterus. J Steroid Biochem Mol Biol. 1998 Jan;64(1-2):25-33. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Nguyen LH, Espert L, Mechti N, Wilson DM 3rd: The human interferon- and estrogen-regulated ISG20/HEM45 gene product degrades single-stranded RNA and DNA in vitro. Biochemistry. 2001 Jun 19;40(24):7174-9. [Article]
- Espert L, Degols G, Gongora C, Blondel D, Williams BR, Silverman RH, Mechti N: ISG20, a new interferon-induced RNase specific for single-stranded RNA, defines an alternative antiviral pathway against RNA genomic viruses. J Biol Chem. 2003 May 2;278(18):16151-8. Epub 2003 Feb 19. [Article]
- Espert L, Degols G, Lin YL, Vincent T, Benkirane M, Mechti N: Interferon-induced exonuclease ISG20 exhibits an antiviral activity against human immunodeficiency virus type 1. J Gen Virol. 2005 Aug;86(Pt 8):2221-9. [Article]
- Espert L, Eldin P, Gongora C, Bayard B, Harper F, Chelbi-Alix MK, Bertrand E, Degols G, Mechti N: The exonuclease ISG20 mainly localizes in the nucleolus and the Cajal (Coiled) bodies and is associated with nuclear SMN protein-containing complexes. J Cell Biochem. 2006 Aug 1;98(5):1320-33. [Article]
- Degols G, Eldin P, Mechti N: ISG20, an actor of the innate immune response. Biochimie. 2007 Jun-Jul;89(6-7):831-5. Epub 2007 Mar 15. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Zhou Z, Wang N, Woodson SE, Dong Q, Wang J, Liang Y, Rijnbrand R, Wei L, Nichols JE, Guo JT, Holbrook MR, Lemon SM, Li K: Antiviral activities of ISG20 in positive-strand RNA virus infections. Virology. 2011 Jan 20;409(2):175-88. doi: 10.1016/j.virol.2010.10.008. Epub 2010 Oct 30. [Article]
- Horio T, Murai M, Inoue T, Hamasaki T, Tanaka T, Ohgi T: Crystal structure of human ISG20, an interferon-induced antiviral ribonuclease. FEBS Lett. 2004 Nov 5;577(1-2):111-6. [Article]