Cytochrome c''
Details
- Name
- Cytochrome c''
- Synonyms
- Cytochrome c'' precursor
- Gene Name
- cycA
- Organism
- Methylophilus methylotrophus
- Amino acid sequence
>lcl|BSEQ0011232|Cytochrome c'' MKIKTIIAVFGVLFSAHALADVTNAEKLVYKYTNIAHSANPMYEAPSITDGKIFFNRKFK TPSGKEAACASCHTNNPANVGKNIVTGKEIPPLAPRVNTKRFTDIDKVEDEFTKHCNDIL GADCSPSEKANFIAYLLTETKPTK
- Number of residues
- 144
- Molecular Weight
- 15791.975
- Theoretical pI
- 8.91
- GO Classification
- Functionselectron carrier activity / heme binding / metal ion bindingProcessesoxidation-reduction process
- General Function
- Metal ion binding
- Specific Function
- Not Available
- Pfam Domain Function
- DUF1924 (PF09086)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0003424|435 bp ATGAAAATCAAAACAATCATTGCCGTATTCGGGGTCTTATTTTCTGCTCATGCATTGGCT GACGTGACTAACGCTGAAAAGTTGGTGTACAAATATACCAATATCGCTCACTCCGCCAAT CCAATGTATGAAGCGCCTTCAATTACTGATGGCAAAATTTTCTTCAACCGCAAATTCAAA ACACCAAGCGGCAAAGAAGCGGCGTGTGCATCTTGTCACACCAATAACCCGGCTAATGTA GGTAAAAACATTGTTACCGGCAAAGAAATCCCACCACTGGCACCACGCGTCAATACCAAA CGCTTCACAGATATCGACAAAGTAGAAGACGAATTCACCAAACACTGTAATGATATTCTG GGTGCAGATTGCTCACCTTCAGAAAAAGCTAACTTCATTGCTTATTTGTTGACAGAAACC AAGCCTACCAAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q9RQB9 UniProtKB Entry Name CYCA_METME GenBank Protein ID 6478241 GenBank Gene ID AF119838 - General References
- Price NJ, Vijgenboom E, Ribeiro G, Costa JV, Canters GW, Santos H: Cloning and sequence analysis of the gene encoding Methylophilus methylotrophus cytochrome c", a unique protein with a perpendicular orientation of the histidinyl ligands. Biochim Biophys Acta. 1999 Sep 1;1413(1):55-61. [Article]
- Klarskov K, Leys D, Backers K, Costa HS, Santos H, Guisez Y, Van Beeumen JJ: Cytochrome c" from the obligate methylotroph Methylophilus methylotrophus, an unexpected homolog of sphaeroides heme protein from the phototroph Rhodobacter sphaeroides. Biochim Biophys Acta. 1999 May 26;1412(1):47-55. [Article]
- Costa HS, Santos H, Turner DL: Characterization of the haem environment in Methylophilus methylotrophus ferricytochrome c" by 1H-NMR. Eur J Biochem. 1993 Aug 1;215(3):817-24. [Article]
- Costa HS, Santos H, Turner DL, Xavier AV: Involvement of a labile axial histidine in coupling electron and proton transfer in Methylophilus methylotrophus cytochrome c''. Eur J Biochem. 1992 Sep 1;208(2):427-33. [Article]
- Berry MJ, George SJ, Thomson AJ, Santos H, Turner DL: Cytochrome c'' isolated from Methylophilus methylotrophus. An example of bis-histidine-co-ordinated Fe3+ haem, with near-perpendicular orientation of the ligands. Biochem J. 1990 Sep 1;270(2):413-7. [Article]
- Enguita FJ, Rodrigues L, Archer M, Sieker L, Rodrigues A, Pohl E, Turner DL, Santos H, Carrondo MA: Crystallization and preliminary X-ray characterization of cytochrome c" from the obligate methylotroph Methylophilus methylotrophus. Acta Crystallogr D Biol Crystallogr. 2003 Mar;59(Pt 3):580-3. Epub 2003 Feb 21. [Article]
- Brennan L, Turner DL, Fareleira P, Santos H: Solution structure of Methylophilus methylotrophus cytochrome c": insights into the structural basis of haem-ligand detachment. J Mol Biol. 2001 Apr 27;308(2):353-65. [Article]