Sialic acid-binding Ig-like lectin 7
Details
- Name
- Sialic acid-binding Ig-like lectin 7
- Synonyms
- Adhesion inhibitory receptor molecule 1
- AIRM-1
- AIRM1
- CDw328
- D-siglec
- p75
- QA79 membrane protein
- Siglec-7
- Gene Name
- SIGLEC7
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0003269|Sialic acid-binding Ig-like lectin 7 MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDP VHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGR YFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPP MISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSYPP QNLTVTVFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDSNPPARLSWTWRSLTLYPSQP SNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQEYTGKMRPVSGVLLGAVGGAG ATALVFLSFCVIFIVVRSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPR HHGLAAHSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEYSEIKIPK
- Number of residues
- 467
- Molecular Weight
- 51142.33
- Theoretical pI
- 7.32
- GO Classification
- Functionscarbohydrate binding / receptor activityProcessescell adhesion / regulation of immune responseComponentsintegral component of plasma membrane / plasma membrane
- General Function
- Receptor activity
- Specific Function
- Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- and alpha-2,6-linked sialic acid. Also binds disialogangliosides (disialogalactosyl globoside, disialyl lactotetraosylceramide and disialyl GalNAc lactotetraoslylceramide). The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Mediates inhibition of natural killer cells cytotoxicity. May play a role in hemopoiesis. Inhibits differentiation of CD34+ cell precursors towards myelomonocytic cell lineage and proliferation of leukemic myeloid cells (in vitro).
- Pfam Domain Function
- Transmembrane Regions
- 354-376
- Cellular Location
- Membrane
- Gene sequence
>lcl|BSEQ0011173|Sialic acid-binding Ig-like lectin 7 (SIGLEC7) ATGCTGCTGCTGCTGCTGCTGCCCCTGCTCTGGGGGAGGGAGAGGGTGGAAGGACAGAAG AGTAACCGGAAGGATTACTCGCTGACGATGCAGAGTTCCGTGACCGTGCAAGAGGGCATG TGTGTCCATGTGCGCTGCTCCTTCTCCTACCCAGTGGACAGCCAGACTGACTCTGACCCA GTTCATGGCTACTGGTTCCGGGCAGGGAATGATATAAGCTGGAAGGCTCCAGTGGCCACA AACAACCCAGCTTGGGCAGTGCAGGAGGAAACTCGGGACCGATTCCACCTCCTTGGGGAC CCACAGACCAAAAATTGCACCCTGAGCATCAGAGATGCCAGAATGAGTGATGCGGGGAGA TACTTCTTTCGTATGGAGAAAGGAAATATAAAATGGAATTATAAATATGACCAGCTCTCT GTGAACGTGACAGGGTAA
- Chromosome Location
- 19
- Locus
- 19q13.3
- External Identifiers
Resource Link UniProtKB ID Q9Y286 UniProtKB Entry Name SIGL7_HUMAN GenBank Protein ID 6466012 GenBank Gene ID AF170485 GenAtlas ID SIGLEC7 HGNC ID HGNC:10876 - General References
- Nicoll G, Ni J, Liu D, Klenerman P, Munday J, Dubock S, Mattei MG, Crocker PR: Identification and characterization of a novel siglec, siglec-7, expressed by human natural killer cells and monocytes. J Biol Chem. 1999 Nov 26;274(48):34089-95. [Article]
- Falco M, Biassoni R, Bottino C, Vitale M, Sivori S, Augugliaro R, Moretta L, Moretta A: Identification and molecular cloning of p75/AIRM1, a novel member of the sialoadhesin family that functions as an inhibitory receptor in human natural killer cells. J Exp Med. 1999 Sep 20;190(6):793-802. [Article]
- Angata T, Varki A: Siglec-7: a sialic acid-binding lectin of the immunoglobulin superfamily. Glycobiology. 2000 Apr;10(4):431-8. [Article]
- Vitale C, Romagnani C, Falco M, Ponte M, Vitale M, Moretta A, Bacigalupo A, Moretta L, Mingari MC: Engagement of p75/AIRM1 or CD33 inhibits the proliferation of normal or leukemic myeloid cells. Proc Natl Acad Sci U S A. 1999 Dec 21;96(26):15091-6. [Article]
- Ito A, Handa K, Withers DA, Satoh M, Hakomori S: Binding specificity of siglec7 to disialogangliosides of renal cell carcinoma: possible role of disialogangliosides in tumor progression. FEBS Lett. 2001 Jun 1;498(1):116-20. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Alphey MS, Attrill H, Crocker PR, van Aalten DM: High resolution crystal structures of Siglec-7. Insights into ligand specificity in the Siglec family. J Biol Chem. 2003 Jan 31;278(5):3372-7. Epub 2002 Nov 15. [Article]
- Dimasi N, Moretta A, Moretta L, Biassoni R, Mariuzza RA: Structure of the saccharide-binding domain of the human natural killer cell inhibitory receptor p75/AIRM1. Acta Crystallogr D Biol Crystallogr. 2004 Feb;60(Pt 2):401-3. Epub 2004 Jan 23. [Article]
- Attrill H, Takazawa H, Witt S, Kelm S, Isecke R, Brossmer R, Ando T, Ishida H, Kiso M, Crocker PR, van Aalten DM: The structure of siglec-7 in complex with sialosides: leads for rational structure-based inhibitor design. Biochem J. 2006 Jul 15;397(2):271-8. [Article]
- Attrill H, Imamura A, Sharma RS, Kiso M, Crocker PR, van Aalten DM: Siglec-7 undergoes a major conformational change when complexed with the alpha(2,8)-disialylganglioside GT1b. J Biol Chem. 2006 Oct 27;281(43):32774-83. Epub 2006 Aug 8. [Article]
- Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [Article]