Calcium-activated potassium channel subunit beta-2
Details
- Name
- Calcium-activated potassium channel subunit beta-2
- Synonyms
- BK channel subunit beta-2
- BKbeta2
- Calcium-activated potassium channel, subfamily M subunit beta-2
- Charybdotoxin receptor subunit beta-2
- Hbeta2
- Hbeta3
- K(VCA)beta-2
- Maxi K channel subunit beta-2
- Slo-beta-2
- Gene Name
- KCNMB2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0012228|Calcium-activated potassium channel subunit beta-2 MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
- Number of residues
- 235
- Molecular Weight
- 27129.37
- Theoretical pI
- 8.47
- GO Classification
- Functionscalcium-activated potassium channel activity / ion channel inhibitor activity / potassium channel regulator activityProcessesaction potential / blood coagulation / detection of calcium ion / neuronal action potential / potassium ion transmembrane transport / potassium ion transport / regulation of vasoconstriction / synaptic transmissionComponentsintegral component of plasma membrane / plasma membrane / voltage-gated potassium channel complex
- General Function
- Potassium channel regulator activity
- Specific Function
- Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Acts as a negative regulator that confers rapid and complete inactivation of KCNMA1 channel complex. May participate in KCNMA1 inactivation in chromaffin cells of the adrenal gland or in hippocampal CA1 neurons.
- Pfam Domain Function
- Transmembrane Regions
- 47-67 195-215
- Cellular Location
- Membrane
- Gene sequence
>lcl|BSEQ0012229|Calcium-activated potassium channel subunit beta-2 (KCNMB2) ATGTTTATATGGACCAGTGGCCGGACCTCTTCATCTTATAGACATGATGAAAAAAGAAAT ATTTACCAGAAAATCAGGGACCATGACCTCCTGGACAAAAGGAAAACAGTCACAGCACTG AAGGCAGGAGAGGACCGAGCTATTCTCCTGGGACTGGCTATGATGGTGTGCTCCATCATG ATGTATTTTCTGCTGGGAATCACACTCCTGCGCTCATACATGCAGAGCGTGTGGACCGAA GAGTCTCAATGCACCTTGCTGAATGCGTCCATCACGGAAACATTTAATTGCTCCTTCAGC TGTGGTCCAGACTGCTGGAAACTTTCTCAGTACCCCTGCCTCCAGGTGTACGTTAACCTG ACTTCTTCCGGGGAAAAGCTCCTCCTCTACCACACAGAAGAGACAATAAAAATCAATCAG AAGTGCTCCTATATACCTAAATGTGGAAAAAATTTTGAAGAATCCATGTCCCTGGTGAAT GTTGTCATGGAAAACTTCAGGAAGTATCAACACTTCTCCTGCTATTCTGACCCAGAAGGA AACCAGAAGAGTGTTATCCTAACAAAACTCTACAGTTCCAACGTGCTGTTCCATTCACTC TTCTGGCCAACCTGTATGATGGCTGGGGGTGTGGCAATTGTTGCCATGGTGAAACTTACA CAGTACCTCTCCCTACTATGTGAGAGGATCCAACGGATCAATAGATAA
- Chromosome Location
- 3
- Locus
- 3q26.2-q27.1
- External Identifiers
Resource Link UniProtKB ID Q9Y691 UniProtKB Entry Name KCMB2_HUMAN GenBank Gene ID AF099137 GenAtlas ID KCNMB2 HGNC ID HGNC:6286 - General References
- Wallner M, Meera P, Toro L: Molecular basis of fast inactivation in voltage and Ca2+-activated K+ channels: a transmembrane beta-subunit homolog. Proc Natl Acad Sci U S A. 1999 Mar 30;96(7):4137-42. [Article]
- Brenner R, Jegla TJ, Wickenden A, Liu Y, Aldrich RW: Cloning and functional characterization of novel large conductance calcium-activated potassium channel beta subunits, hKCNMB3 and hKCNMB4. J Biol Chem. 2000 Mar 3;275(9):6453-61. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Xia XM, Ding JP, Lingle CJ: Molecular basis for the inactivation of Ca2+- and voltage-dependent BK channels in adrenal chromaffin cells and rat insulinoma tumor cells. J Neurosci. 1999 Jul 1;19(13):5255-64. [Article]
- Meera P, Wallner M, Toro L: A neuronal beta subunit (KCNMB4) makes the large conductance, voltage- and Ca2+-activated K+ channel resistant to charybdotoxin and iberiotoxin. Proc Natl Acad Sci U S A. 2000 May 9;97(10):5562-7. [Article]
- Xia XM, Ding JP, Lingle CJ: Inactivation of BK channels by the NH2 terminus of the beta2 auxiliary subunit: an essential role of a terminal peptide segment of three hydrophobic residues. J Gen Physiol. 2003 Feb;121(2):125-48. [Article]
- Orio P, Rojas P, Ferreira G, Latorre R: New disguises for an old channel: MaxiK channel beta-subunits. News Physiol Sci. 2002 Aug;17:156-61. [Article]
- Bentrop D, Beyermann M, Wissmann R, Fakler B: NMR structure of the "ball-and-chain" domain of KCNMB2, the beta 2-subunit of large conductance Ca2+- and voltage-activated potassium channels. J Biol Chem. 2001 Nov 9;276(45):42116-21. Epub 2001 Aug 21. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB03861 (2R,3R,4S,5R)-2-acetamido-3,4-dihydroxy-5-hydroxymethyl-piperidine experimental unknown Details DB00721 Procaine approved, investigational, vet_approved unknown blocker Details DB09089 Trimebutine approved yes inhibitor Details DB01110 Miconazole approved, investigational, vet_approved unknown inhibitor Details DB00867 Ritodrine approved, investigational yes activator Details DB01054 Nitrendipine approved, investigational unknown inhibitor Details DB02587 Colforsin experimental, investigational unknown activator Details