Genome polyprotein

Details

Name
Genome polyprotein
Synonyms
Not Available
Gene Name
NS3/4A
Organism
Hepatitis C Virus
Amino acid sequence
>lcl|BSEQ0021396|Genome polyprotein
APITAYAQQTRGLLGTIVTGLTGRDKNVVTGEVQVLSTATQTFLGTTVGGVMWTVYHGAG
SRTLAGAKHPALQMYTNVDQDLVGWPAPSGAKSLEPCACGSADLYLITRDADVIPARRRG
DSTASLLSPRPLACLKGSSGGPVMCPSGHVAGIFRAAVCTRGVAKALQFIPVETLSTQAR
SPSFSDNSTPPAVPQSYQVGYLHAPTGSGKSTKVPAAYVAQGYNVLVLNPSVAATLGFGS
FMSRAYGVDPNIRTGNRTVTTGAKLTYSTYGKFLADGGCSGGAYDVIICDECHAQDATSI
LGIGTVLDQAETAGVRLTVLATATPPGSITVPHSNIEEVALGSEGEIPFYGKAIPIALLK
GGRHLIFCHSKKKCEEIASKLRGMGLNAVAYYRGLDVSVIPTTGDVVVCATDALMTGYTG
DFDSVIDCNVAVEQYVDFSLDPTFSIETRTAPQDAVSRSQRRGRTGRGRLGTYRYVAPGE
RPSGMFDSVVLCECYDAGCSWYDLQPAETTVRLRAYLSTPGLPVCQDHLDFWESVFTGLT
HIDAHFLSQTKQQGLNFSYLTAYQATVCARAQAPPPSWDETWKCLVRLKPTLHGPTPLLY
RLGPIQNETCLTHPVTKYIMACMSADLEVTTSTWVLLGGVLAALAAYCLSVGSVVIVGHI
ELGGKPALVPDREVLYQQYDEMEEC
Number of residues
685
Molecular Weight
72789.28
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / ATP-dependent helicase activity / RNA-directed RNA polymerase activity / serine-type peptidase activity
Processes
transformation of host cell by virus / viral genome replication
Components
virion
General Function
Serine-type peptidase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDB0B3C9
UniProtKB Entry NameB0B3C9_9HEPC
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05521Telaprevirapproved, withdrawnyesinhibitorDetails
DB08873Boceprevirapproved, withdrawnyesinhibitorDetails
DB09297Paritaprevirapproved, investigationalyesinhibitorDetails
DB11575GrazoprevirapprovedyesantagonistDetails
DB12026Voxilaprevirapproved, investigationalyesinhibitorDetails