Ferredoxin--NADP reductase, apicoplast

Details

Name
Ferredoxin--NADP reductase, apicoplast
Synonyms
  • 1.18.1.2
Gene Name
Not Available
Organism
Plasmodium falciparum (isolate 3D7)
Amino acid sequence
>lcl|BSEQ0051982|Ferredoxin--NADP reductase, apicoplast
MKIRFVFILSVLISGVCCISKNVSRRVANRMTAHSRFLFVHDKYKRNKNFKLKNNKEENN
FINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNELDN
NPNNQINKDHNIINTTNHTNHNNIALSHIKKQRCARLYSISSSNNMENLSVAIKIHKYEQ
TENAPNITNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPY
ISFLKKLFAYDKNNLYNRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYV
FSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGHKSIRYKVMDILKSHDQFDE
KKKKRVHVEVY
Number of residues
371
Molecular Weight
43778.59
Theoretical pI
Not Available
GO Classification
Functions
electron transfer activity / FAD binding / ferredoxin-NAD(P) reductase activity / ferredoxin-NADP+ reductase activity / identical protein binding
Processes
oxidation-reduction process
Components
apicoplast
General Function
Not Available
Specific Function
Electron transfer activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Plastid
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDC6KT68
UniProtKB Entry NameFENR_PLAF7
General References
  1. Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [Article]
  2. Hall N, Pain A, Berriman M, Churcher C, Harris B, Harris D, Mungall K, Bowman S, Atkin R, Baker S, Barron A, Brooks K, Buckee CO, Burrows C, Cherevach I, Chillingworth C, Chillingworth T, Christodoulou Z, Clark L, Clark R, Corton C, Cronin A, Davies R, Davis P, Dear P, Dearden F, Doggett J, Feltwell T, Goble A, Goodhead I, Gwilliam R, Hamlin N, Hance Z, Harper D, Hauser H, Hornsby T, Holroyd S, Horrocks P, Humphray S, Jagels K, James KD, Johnson D, Kerhornou A, Knights A, Konfortov B, Kyes S, Larke N, Lawson D, Lennard N, Line A, Maddison M, McLean J, Mooney P, Moule S, Murphy L, Oliver K, Ormond D, Price C, Quail MA, Rabbinowitsch E, Rajandream MA, Rutter S, Rutherford KM, Sanders M, Simmonds M, Seeger K, Sharp S, Smith R, Squares R, Squares S, Stevens K, Taylor K, Tivey A, Unwin L, Whitehead S, Woodward J, Sulston JE, Craig A, Newbold C, Barrell BG: Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13. Nature. 2002 Oct 3;419(6906):527-31. [Article]
  3. Kimata-Ariga Y, Kurisu G, Kusunoki M, Aoki S, Sato D, Kobayashi T, Kita K, Horii T, Hase T: Cloning and characterization of ferredoxin and ferredoxin-NADP+ reductase from human malaria parasite. J Biochem. 2007 Mar;141(3):421-8. doi: 10.1093/jb/mvm046. Epub 2007 Jan 23. [Article]
  4. Milani M, Balconi E, Aliverti A, Mastrangelo E, Seeber F, Bolognesi M, Zanetti G: Ferredoxin-NADP+ reductase from Plasmodium falciparum undergoes NADP+-dependent dimerization and inactivation: functional and crystallographic analysis. J Mol Biol. 2007 Mar 23;367(2):501-13. doi: 10.1016/j.jmb.2007.01.005. Epub 2007 Jan 9. [Article]
  5. Crobu D, Canevari G, Milani M, Pandini V, Vanoni MA, Bolognesi M, Zanetti G, Aliverti A: Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis. Biochemistry. 2009 Oct 13;48(40):9525-33. doi: 10.1021/bi9013209. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06608Tafenoquineapproved, investigationalunknownsubstrateDetails