Metallo-beta-lactamase type 2
Details
- Name
- Metallo-beta-lactamase type 2
- Synonyms
- 3.5.2.6
- B2 metallo-beta-lactamase
- Beta-lactamase type II
- Metallo-beta-lactamase NDM-1
- Metallo-beta-lactamase type II
- NDM-1
- New Delhi metallo-beta-lactamase-1
- Gene Name
- blaNDM-1
- Organism
- Klebsiella pneumoniae
- Amino acid sequence
>lcl|BSEQ0052481|Metallo-beta-lactamase type 2 MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ HTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTH AHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPL KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF PKASMIVMSHSAPDSRAAITHTARMADKLR
- Number of residues
- 270
- Molecular Weight
- 28499.225
- Theoretical pI
- Not Available
- GO Classification
- Functionsbeta-lactamase activity / zinc ion bindingProcessesantibiotic catabolic process / response to antibioticComponentsperiplasmic space
- General Function
- Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
- Specific Function
- Beta-lactamase activity
- Pfam Domain Function
- Lactamase_B (PF00753)
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID C7C422 UniProtKB Entry Name BLAN1_KLEPN - General References
- Yong D, Toleman MA, Giske CG, Cho HS, Sundman K, Lee K, Walsh TR: Characterization of a new metallo-beta-lactamase gene, bla(NDM-1), and a novel erythromycin esterase gene carried on a unique genetic structure in Klebsiella pneumoniae sequence type 14 from India. Antimicrob Agents Chemother. 2009 Dec;53(12):5046-54. doi: 10.1128/AAC.00774-09. Epub 2009 Sep 21. [Article]
- Kumarasamy KK, Toleman MA, Walsh TR, Bagaria J, Butt F, Balakrishnan R, Chaudhary U, Doumith M, Giske CG, Irfan S, Krishnan P, Kumar AV, Maharjan S, Mushtaq S, Noorie T, Paterson DL, Pearson A, Perry C, Pike R, Rao B, Ray U, Sarma JB, Sharma M, Sheridan E, Thirunarayan MA, Turton J, Upadhyay S, Warner M, Welfare W, Livermore DM, Woodford N: Emergence of a new antibiotic resistance mechanism in India, Pakistan, and the UK: a molecular, biological, and epidemiological study. Lancet Infect Dis. 2010 Sep;10(9):597-602. doi: 10.1016/S1473-3099(10)70143-2. Epub 2010 Aug 10. [Article]
- Authors unspecified: Detection of Enterobacteriaceae isolates carrying metallo-beta-lactamase - United States, 2010. MMWR Morb Mortal Wkly Rep. 2010 Jun 25;59(24):750. [Article]
- King DT, Worrall LJ, Gruninger R, Strynadka NC: New Delhi metallo-beta-lactamase: structural insights into beta-lactam recognition and inhibition. J Am Chem Soc. 2012 Jul 18;134(28):11362-5. doi: 10.1021/ja303579d. Epub 2012 Jul 5. [Article]
- Klingler FM, Wichelhaus TA, Frank D, Cuesta-Bernal J, El-Delik J, Muller HF, Sjuts H, Gottig S, Koenigs A, Pos KM, Pogoryelov D, Proschak E: Approved Drugs Containing Thiols as Inhibitors of Metallo-beta-lactamases: Strategy To Combat Multidrug-Resistant Bacteria. J Med Chem. 2015 Apr 23;58(8):3626-30. doi: 10.1021/jm501844d. Epub 2015 Apr 13. [Article]