Hepatocyte growth factor-regulated tyrosine kinase substrate
Details
- Name
- Hepatocyte growth factor-regulated tyrosine kinase substrate
- Synonyms
- HRS
- Protein pp110
- Gene Name
- HGS
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0009544|Hepatocyte growth factor-regulated tyrosine kinase substrate MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHV ALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFR NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKH HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTS PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASS APPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQ PGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFV NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDA RGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQE KERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVE GSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAY SSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPS QDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD
- Number of residues
- 777
- Molecular Weight
- 86191.46
- Theoretical pI
- Not Available
- GO Classification
- Functionsmetal ion binding / protein domain specific bindingProcessesendosomal transport / endosome to lysosome transport / epidermal growth factor receptor signaling pathway / membrane invagination / membrane organization / negative regulation of cell proliferation / negative regulation of epidermal growth factor receptor signaling pathway / negative regulation of JAK-STAT cascade / positive regulation of exosomal secretion / positive regulation of gene expression / post-Golgi vesicle-mediated transport / protein localization to membrane / protein targeting to lysosome / regulation of MAP kinase activity / regulation of protein catabolic process / signal transductionComponentscytoplasm / cytosol / early endosome / early endosome membrane / endosome / extracellular exosome / intracellular membrane-bounded organelle / multivesicular body membrane / secretory granule
- General Function
- Protein domain specific binding
- Specific Function
- Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. May contribute to the efficient recruitment of SMADs to the activin receptor complex. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0013223|Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) ATGGGGCGAGGCAGCGGCACCTTCGAGCGTCTCCTAGACAAGGCGACCAGCCAGCTCCTG TTGGAGACAGATTGGGAGTCCATTTTGCAGATCTGCGACCTGATCCGCCAAGGGGACACA CAAGCAAAATATGCTGTGAATTCCATCAAGAAGAAAGTCAACGACAAGAACCCACACGTC GCCTTGTATGCCCTGGAGGTCATGGAATCTGTGGTAAAGAACTGTGGCCAGACAGTTCAT GATGAGGTGGCCAACAAGCAGACCATGGAGGAGCTGAAGGACCTGCTGAAGAGACAAGTG GAGGTAAACGTCCGTAACAAGATCCTGTACCTGATCCAGGCCTGGGCGCATGCCTTCCGG AACGAGCCCAAGTACAAGGTGGTCCAGGACACCTACCAGATCATGAAGGTGGAGGGGCAC GTCTTTCCAGAATTCAAAGAGAGCGATGCCATGTTTGCTGCCGAGAGAGCCCCAGACTGG GTGGACGCTGAGGAATGCCACCGCTGCAGGGTGCAGTTCGGGGTGATGACCCGTAAGCAC CACTGCCGGGCGTGTGGGCAGATATTCTGTGGAAAGTGTTCTTCCAAGTACTCCACCATC CCCAAGTTTGGCATCGAGAAGGAGGTGCGCGTGTGTGAGCCCTGCTACGAGCAGCTGAAC AGGAAAGCGGAGGGAAAGGCCACTTCCACCACTGAGCTGCCCCCCGAGTACCTGACCAGC CCCCTGTCTCAGCAGTCCCAGCTGCCCCCCAAGAGGGACGAGACGGCCCTGCAGGAGGAG GAGGAGCTGCAGCTGGCCCTGGCGCTGTCACAGTCAGAGGCGGAGGAGAAGGAGAGGCTG AGACAGAAGTCCACGTACACTTCGTACCCCAAGGCGGAGCCCATGCCCTCGGCCTCCTCA GCGCCCCCCGCCAGCAGCCTGTACTCTTCACCTGTGAACTCGTCGGCGCCTCTGGCTGAG GACATCGACCCTGAGCTCGCACGGTATCTCAACCGGAACTACTGGGAGAAGAAGCAGGAG GAGGCTCGCAAGAGCCCCACGCCATCTGCGCCCGTGCCCCTGACGGAGCCGGCTGCACAG CCTGGGGAAGGGCACGCAGCCCCCACCAACGTGGTGGAGAACCCCCTCCCGGAGACAGAC TCTCAGCCCATTCCTCCCTCTGGTGGCCCCTTTAGTGAGCCACAGTTCCACAATGGCGAG TCTGAGGAGAGCCACGAGCAGTTCCTGAAGGCGCTGCAGAACGCCGTCACCACCTTCGTG AACCGCATGAAGAGTAACCACATGCGGGGCCGCAGCATCACCAATGACTCGGCCGTGCTC TCACTCTTCCAGTCCATCAACGGCATGCACCCGCAGCTGCTGGAGCTGCTCAACCAGCTG GACGAGCGCAGGCTGTACTATGAGGGGCTGCAGGACAAGCTGGCACAGATCCGCGATGCC CGGGGGGCGCTGAGTGCCCTGCGCGAAGAGCACCGGGAGAAGCTTCGCCGGGCAGCCGAG GAGGCAGAGCGCCAGCGCCAGATCCAGCTGGCCCAGAAGCTGGAGATAATGCGGCAGAAG AAGCAGGAGTACCTGGAGGTGCAGAGGCAGCTGGCCATCCAGCGCCTGCAGGAGCAGGAG AAGGAGCGGCAGATGCGGCTGGAGCAGCAGAAGCAGACGGTCCAGATGCGCGCGCAGATG CCCGCCTTCCCCCTGCCCTACGCCCAGCTCCAGGCCATGCCCGCAGCCGGAGGTGTGCTC TACCAGCCCTCGGGACCAGCCAGCTTCCCCAGCACCTTCAGCCCTGCCGGCTCGGTGGAG GGCTCCCCAATGCACGGCGTGTACATGAGCCAGCCGGCCCCTGCCGCTGGCCCCTACCCC AGCATGCCCAGCACTGCGGCTGATCCCAGCATGGTGAGTGCCTACATGTACCCAGCAGGG GCCACTGGGGCGCAGGCGGCCCCCCAGGCCCAGGCCGGACCCACCGCCAGCCCCGCTTAC TCATCCTACCAGCCTACTCCCACAGCGGGCTACCAGAACGTGGCCTCCCAGGCCCCACAG AGCCTCCCGGCCATCTCTCAGCCTCCGCAGTCCAGCACCATGGGCTACATGGGGAGCCAG TCAGTCTCCATGGGCTACCAGCCTTACAACATGCAGAATCTCATGACCACCCTCCCAAGC CAGGATGCGTCTCTGCCACCCCAGCAGCCCTACATCGCGGGGCAGCAGCCCATGTACCAG CAGATGGCACCCTCTGGCGGTCCCCCCCAGCAGCAGCCCCCCGTGGCCCAGCAACCGCAG GCACAGGGGCCGCCGGCACAGGGCAGCGAGGCCCAGCTCATTTCATTCGACTGA
- Chromosome Location
- 17
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID O14964 UniProtKB Entry Name HGS_HUMAN HGNC ID HGNC:4897 - General References
- Asao H, Sasaki Y, Arita T, Tanaka N, Endo K, Kasai H, Takeshita T, Endo Y, Fujita T, Sugamura K: Hrs is associated with STAM, a signal-transducing adaptor molecule. Its suppressive effect on cytokine-induced cell growth. J Biol Chem. 1997 Dec 26;272(52):32785-91. [Article]
- Lu L, Komada M, Kitamura N: Human Hrs, a tyrosine kinase substrate in growth factor-stimulated cells: cDNA cloning and mapping of the gene to chromosome 17. Gene. 1998 Jun 15;213(1-2):125-32. [Article]
- Scoles DR, Huynh DP, Chen MS, Burke SP, Gutmann DH, Pulst SM: The neurofibromatosis 2 tumor suppressor protein interacts with hepatocyte growth factor-regulated tyrosine kinase substrate. Hum Mol Genet. 2000 Jul 1;9(11):1567-74. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Komada M, Masaki R, Yamamoto A, Kitamura N: Hrs, a tyrosine kinase substrate with a conserved double zinc finger domain, is localized to the cytoplasmic surface of early endosomes. J Biol Chem. 1997 Aug 15;272(33):20538-44. [Article]
- Marchese A, Raiborg C, Santini F, Keen JH, Stenmark H, Benovic JL: The E3 ubiquitin ligase AIP4 mediates ubiquitination and sorting of the G protein-coupled receptor CXCR4. Dev Cell. 2003 Nov;5(5):709-22. [Article]
- Bache KG, Raiborg C, Mehlum A, Stenmark H: STAM and Hrs are subunits of a multivalent ubiquitin-binding complex on early endosomes. J Biol Chem. 2003 Apr 4;278(14):12513-21. Epub 2003 Jan 27. [Article]
- Pornillos O, Higginson DS, Stray KM, Fisher RD, Garrus JE, Payne M, He GP, Wang HE, Morham SG, Sundquist WI: HIV Gag mimics the Tsg101-recruiting activity of the human Hrs protein. J Cell Biol. 2003 Aug 4;162(3):425-34. [Article]
- Eastman SW, Martin-Serrano J, Chung W, Zang T, Bieniasz PD: Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding. J Biol Chem. 2005 Jan 7;280(1):628-36. Epub 2004 Oct 27. [Article]
- Regan-Klapisz E, Sorokina I, Voortman J, de Keizer P, Roovers RC, Verheesen P, Urbe S, Fallon L, Fon EA, Verkleij A, Benmerah A, van Bergen en Henegouwen PM: Ubiquilin recruits Eps15 into ubiquitin-rich cytoplasmic aggregates via a UIM-UBL interaction. J Cell Sci. 2005 Oct 1;118(Pt 19):4437-50. Epub 2005 Sep 13. [Article]
- Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [Article]
- Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [Article]
- Webber E, Li L, Chin LS: Hypertonia-associated protein Trak1 is a novel regulator of endosome-to-lysosome trafficking. J Mol Biol. 2008 Oct 10;382(3):638-51. doi: 10.1016/j.jmb.2008.07.045. Epub 2008 Jul 25. [Article]
- Yan Q, Sun W, Kujala P, Lotfi Y, Vida TA, Bean AJ: CART: an Hrs/actinin-4/BERP/myosin V protein complex required for efficient receptor recycling. Mol Biol Cell. 2005 May;16(5):2470-82. Epub 2005 Mar 16. [Article]
- Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [Article]
- Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [Article]
- He J, Vora M, Haney RM, Filonov GS, Musselman CA, Burd CG, Kutateladze AG, Verkhusha VV, Stahelin RV, Kutateladze TG: Membrane insertion of the FYVE domain is modulated by pH. Proteins. 2009 Sep;76(4):852-60. doi: 10.1002/prot.22392. [Article]
- Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [Article]
- Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Shea FF, Rowell JL, Li Y, Chang TH, Alvarez CE: Mammalian alpha arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with beta arrestins. PLoS One. 2012;7(12):e50557. doi: 10.1371/journal.pone.0050557. Epub 2012 Dec 7. [Article]
- Han SO, Kommaddi RP, Shenoy SK: Distinct roles for beta-arrestin2 and arrestin-domain-containing proteins in beta2 adrenergic receptor trafficking. EMBO Rep. 2013 Feb;14(2):164-71. doi: 10.1038/embor.2012.187. Epub 2012 Dec 4. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Hirano S, Kawasaki M, Ura H, Kato R, Raiborg C, Stenmark H, Wakatsuki S: Double-sided ubiquitin binding of Hrs-UIM in endosomal protein sorting. Nat Struct Mol Biol. 2006 Mar;13(3):272-7. Epub 2006 Feb 5. [Article]
- Ren X, Kloer DP, Kim YC, Ghirlando R, Saidi LF, Hummer G, Hurley JH: Hybrid structural model of the complete human ESCRT-0 complex. Structure. 2009 Mar 11;17(3):406-16. doi: 10.1016/j.str.2009.01.012. [Article]
- Im YJ, Kuo L, Ren X, Burgos PV, Zhao XZ, Liu F, Burke TR Jr, Bonifacino JS, Freed EO, Hurley JH: Crystallographic and functional analysis of the ESCRT-I /HIV-1 Gag PTAP interaction. Structure. 2010 Nov 10;18(11):1536-47. doi: 10.1016/j.str.2010.08.010. [Article]
- Ley TJ, Mardis ER, Ding L, Fulton B, McLellan MD, Chen K, Dooling D, Dunford-Shore BH, McGrath S, Hickenbotham M, Cook L, Abbott R, Larson DE, Koboldt DC, Pohl C, Smith S, Hawkins A, Abbott S, Locke D, Hillier LW, Miner T, Fulton L, Magrini V, Wylie T, Glasscock J, Conyers J, Sander N, Shi X, Osborne JR, Minx P, Gordon D, Chinwalla A, Zhao Y, Ries RE, Payton JE, Westervelt P, Tomasson MH, Watson M, Baty J, Ivanovich J, Heath S, Shannon WD, Nagarajan R, Walter MJ, Link DC, Graubert TA, DiPersio JF, Wilson RK: DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome. Nature. 2008 Nov 6;456(7218):66-72. doi: 10.1038/nature07485. [Article]