NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Details
- Name
- NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
- Synonyms
- CI-MWFE
- Complex I-MWFE
- NADH-ubiquinone oxidoreductase MWFE subunit
- Gene Name
- NDUFA1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0010017|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY YVSKGLENID
- Number of residues
- 70
- Molecular Weight
- 8072.325
- Theoretical pI
- 9.12
- GO Classification
- FunctionsNADH dehydrogenase (ubiquinone) activityProcessescellular metabolic process / mitochondrial electron transport, NADH to ubiquinone / respiratory electron transport chain / small molecule metabolic processComponentsintegral component of membrane / mitochondrial inner membrane / mitochondrial membrane / mitochondrial respiratory chain complex I / mitochondrion
- General Function
- Nadh dehydrogenase (ubiquinone) activity
- Specific Function
- Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
- Pfam Domain Function
- MWFE (PF15879)
- Transmembrane Regions
- 1-21
- Cellular Location
- Mitochondrion inner membrane
- Gene sequence
>lcl|BSEQ0010018|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 (NDUFA1) ATGTGGTTCGAGATTCTCCCCGGACTCTCCGTCATGGGCGTGTGCTTGTTGATTCCAGGA CTGGCTACTGCGTACATCCACAGGTTCACTAACGGGGGCAAGGAAAAAAGGGTTGCTCAT TTTGGGTATCACTGGAGTCTGATGGAAAGAGATAGGCGCATCTCTGGAGTTGATCGTTAC TATGTGTCAAAGGGTTTGGAGAACATTGATTAA
- Chromosome Location
- X
- Locus
- Xq24
- External Identifiers
Resource Link UniProtKB ID O15239 UniProtKB Entry Name NDUA1_HUMAN GenBank Protein ID 2274974 GenBank Gene ID X81900 GenAtlas ID NDUFA1 HGNC ID HGNC:7683 - General References
- Zhuchenko O, Wehnert M, Bailey J, Sun ZS, Lee CC: Isolation, mapping, and genomic structure of an X-linked gene for a subunit of human mitochondrial complex I. Genomics. 1996 Nov 1;37(3):281-8. [Article]
- Frattini A, Faranda S, Bagnasco L, Patrosso C, Nulli P, Zucchi I, Vezzoni P: Identification of a new member (ZNF183) of the Ring finger gene family in Xq24-25. Gene. 1997 Jun 19;192(2):291-8. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Murray J, Zhang B, Taylor SW, Oglesbee D, Fahy E, Marusich MF, Ghosh SS, Capaldi RA: The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification. J Biol Chem. 2003 Apr 18;278(16):13619-22. Epub 2003 Feb 28. [Article]
- Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [Article]
- Fernandez-Moreira D, Ugalde C, Smeets R, Rodenburg RJ, Lopez-Laso E, Ruiz-Falco ML, Briones P, Martin MA, Smeitink JA, Arenas J: X-linked NDUFA1 gene mutations associated with mitochondrial encephalomyopathy. Ann Neurol. 2007 Jan;61(1):73-83. [Article]