Maltogenic amylase

Details

Name
Maltogenic amylase
Synonyms
Not Available
Gene Name
Not Available
Organism
Thermus sp. IM6501
Amino acid sequence
>lcl|BSEQ0017024|Maltogenic amylase
MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMR
KTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFL
HRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIID
HLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVM
LDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNT
AHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGEIWH
DAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLL
GSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPE
KQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNE
AAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW
Number of residues
588
Molecular Weight
68209.815
Theoretical pI
5.86
GO Classification
Functions
cation binding / hydrolase activity, hydrolyzing O-glycosyl compounds
Processes
carbohydrate metabolic process
General Function
Hydrolase activity, hydrolyzing o-glycosyl compounds
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0006247|1767 bp
ATGAGGAAAGAAGCCATCCACCACCGCTCAACCGACAATTTCGCTTATGCTTATGACAGC
GAGACGCTCCATCTCCGGCTTCAAACAAAGAAAAATGATGTCGACCACGTCGAGCTGCTT
TTTGGCGACCCGTACGAATGGCACGATGGCGCCTGGCAGTTTCAAACGATGCCGATGCGG
AAAACGGGGAGCGACGGGTTGTTTGACTATTGGCTCGCCGAAGTCAAACCGCCATATCGA
CGGCTGCGCTATGGGTTTGTGCTTCGAGCTGGGGGCGAGAAACTGGTCTATACGGAAAAA
GGATTTTACCATGAAGCTCCGAGCGACGACACCGCTTACTACTTTTGCTTCCCCTTTCTT
CATCGGGTCGACCTATTCCAAGCGCCGGACTGGGTAAAAGACACAGTATGGTATCAAATT
TTCCCCGAGCGGTTCGCCAACGGCAACCCGGCCATCAGTCCGAAAGGGGCGCGGCCGTGG
GGAAGCGAGGACCCGACGCCGACGAGCTTTTTCGGCGGCGACTTGCAAGGAATCATCGAT
CACCTTGACTATTTGGCTGATCTCGGTATTACCGGCATTTACTTGACGCCGATTTTCCGC
GCACCGTCCAATCATAAATACGACACCGCTGATTATTTTGAAATCGACCCGCACTTTGGG
GACAAAGAGACGTTGAAAACACTTGTCAAGCGCTGCCATGAAAAAGGGATCCGCGTCATG
CTCGATGCAGTCTTCAACCATTGCGGCTATGAGTTTGCCCCGTTTCAAGATGTGCTGAAA
AACGGCGCAGCCTCTCGGTATAAAGATTGGTTCCATATTCGCGAGTTTCCGCTCCAAACC
GAGCCGCGCCCGAACTACGACACGTTTGCGTTCGTGCCGCACATGCCGAAACTCAACACC
GCTCATCCGGAAGTGAAGCGCTACTTGCTTGATGTCGCGACATACTGGATTCGCGAGTTT
GATATTGACGGCTGGCGGCTCGATGTGGCGAACGAAATCGATCATCAATTTTGGCGCGAA
TTCCGGCAGGCAGTGAAGGCGCTAAAGCCCGATGTGTACATTCTCGGCGAGATTTGGCAT
GACGCCATGCCTTGGCTGCGCGGCGACCAGTTTGACGCCGTCATGAACTACCCGTTGGCG
GACGCGGCGCTCCGCTTTTTCGCCAAAGAAGACATGAGCGCCAGCGAGTTTGCCGACCGA
TTGATGCATGTGCTTCATTCCTATCCAAAACAGGTCAACGAAGCGGCGTTTAACTTGCTT
GGCAGCCATGATACACCAAGGCTGCTCACTGTTTGCGGCGGCGACGTCCGCAAAGTGAAG
TTGTTGTTTTTGTTCCAGCTCACGTTCACTGGTTCGCCGTGTATTTACTATGGCGATGAG
ATCGGCATGACGGGTGGAAACGATCCGGAATGCCGGAAGTGTATGGTGTGGGATCCAGAG
AAGCAAAACAAAGAACTGTATGAACATGTCAAGCAACTGATCGCTCTTCGCAAGCAATAT
CGGGCGCTTCGACGCGGCGATGTCGCTTTTCTCACCGCCGATGATGAAGTGAACCATCTT
GTTTATGCAAAAACGGATGGCAATGAAACGGTCATGATCATCATCAACCGGAGCAACGAA
GCAGCAGAAATTCCCATGCCGATCGATGCGCGTGGAAAATGGCTGGTCAACCTTCTGACA
GGGGAGCGGTTCGCTGCAGAGGCGGAAACACTTTGCGTCTCCTTGCCGCCGTACGGGTTT
GTGCTTTACGCGGTCGAAAGCTGGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO69007
UniProtKB Entry NameO69007_9DEIN
GenBank Gene IDAF060204
General References
  1. Kim TJ, Kim MJ, Kim BC, Kim JC, Cheong TK, Kim JW, Park KH: Modes of action of acarbose hydrolysis and transglycosylation catalyzed by a thermostable maltogenic amylase, the gene for which was cloned from a Thermus strain. Appl Environ Microbiol. 1999 Apr;65(4):1644-51. [PubMed:10103262]
  2. Kim JS, Cha SS, Kim HJ, Kim TJ, Ha NC, Oh ST, Cho HS, Cho MJ, Kim MJ, Lee HS, Kim JW, Choi KY, Park KH, Oh BH: Crystal structure of a maltogenic amylase provides insights into a catalytic versatility. J Biol Chem. 1999 Sep 10;274(37):26279-86. [PubMed:10473583]
  3. Lee HS, Kim MS, Cho HS, Kim JI, Kim TJ, Choi JH, Park C, Lee HS, Oh BH, Park KH: Cyclomaltodextrinase, neopullulanase, and maltogenic amylase are nearly indistinguishable from each other. J Biol Chem. 2002 Jun 14;277(24):21891-7. Epub 2002 Mar 28. [PubMed:11923309]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03995BetadexexperimentalunknownDetails