Phenazine biosynthesis protein

Details

Name
Phenazine biosynthesis protein
Synonyms
  • Phenazine biosynthesis protein phzD
  • Phenazine biosynthesis protein PhzG
  • phzD
  • PhzG
  • phzG1
  • phzG1_1
  • phzG1_2
  • Putative pyridoxamine 5'-phosphate oxidase
  • Pyridoxamine 5'-phosphate oxidase
Gene Name
phzG
Organism
Pseudomonas aeruginosa
Amino acid sequence
>lcl|BSEQ0022501|Phenazine biosynthesis protein
MGVNANISESLTGTIEAPFPEFEAPPANPMEVLRNWLERARRYGVREPRALALATVDGQG
RPSTRIVVIAELGERGVVFATHADSQKGRELAQNPWASGVLYWRESSQQIILNGRAERLP
DERADAQWLSRPYQTHPMSIASRQSETLADIHALRAEARRLAETDGPLPRPPGYCLFELC
LESVEFWGNGTERLHERLRYDRDEGGWKHRYLQP
Number of residues
214
Molecular Weight
24268.005
Theoretical pI
6.37
GO Classification
Functions
FMN binding / pyridoxamine-phosphate oxidase activity
Processes
phenazine biosynthetic process / pyridoxine biosynthetic process
General Function
Pyridoxamine-phosphate oxidase activity
Specific Function
Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0022502|Phenazine biosynthesis protein (phzG)
ATGGGCGTCAACGCGAACATTTCCGAGTCCCTCACCGGGACCATCGAAGCCCCTTTCCCG
GAGTTCGAGGCGCCGCCGGCGAACCCCATGGAGGTGCTGCGCAACTGGCTGGAACGCGCC
CGCCGCTACGGCGTGCGCGAGCCGCGGGCACTGGCCCTGGCCACGGTCGACGGGCAGGGC
CGGCCGTCGACGCGGATCGTGGTGATCGCCGAGCTGGGCGAGCGCGGGGTGGTGTTCGCC
ACCCACGCCGATAGCCAGAAGGGCCGCGAACTGGCGCAGAACCCCTGGGCCTCGGGGGTG
CTGTACTGGCGCGAGAGCAGCCAGCAGATCATCCTCAACGGCCGCGCCGAACGCCTGCCC
GACGAGCGCGCCGACGCCCAGTGGCTGAGCCGCCCGTACCAGACCCACCCGATGTCGATC
GCCTCGCGGCAGAGCGAAACCCTCGCCGACATCCACGCCCTGCGCGCCGAAGCCCGGCGC
CTGGCGGAAACCGACGGCCCGCTGCCGCGCCCGCCGGGCTACTGCCTGTTCGAACTGTGC
CTGGAGTCGGTGGAGTTCTGGGGCAACGGCACCGAGCGGCTGCACGAGCGCCTGCGCTAC
GACCGCGACGAAGGAGGCTGGAAGCACCGCTACCTGCAACCGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO69755
UniProtKB Entry NameO69755_PSEAI
GenBank Gene IDAF005404
General References
  1. Parsons JF, Calabrese K, Eisenstein E, Ladner JE: Structure of the phenazine biosynthesis enzyme PhzG. Acta Crystallogr D Biol Crystallogr. 2004 Nov;60(Pt 11):2110-3. Epub 2004 Oct 20. [PubMed:15502343]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails