Cytochrome c'
Details
- Name
- Cytochrome c'
- Synonyms
- Not Available
- Gene Name
- Not Available
- Organism
- Rhodobacter capsulatus
- Amino acid sequence
>lcl|BSEQ0016826|Cytochrome c' ADTKEVLEAREAYFKSLGKSMKAMTGVAKSFDAEAAKAEAAALEKILATDVAPLFPAGTS STDLPGQTEAKAAIWTNMADFGAKGKAMNDAGAEVIAAANAGDATAFGAALQKLGGTCKA CHDDYREED
- Number of residues
- 129
- Molecular Weight
- 13205.62
- Theoretical pI
- 4.5
- GO Classification
- Functionselectron carrier activity / heme binding / iron ion bindingProcesseselectron transport chainComponentsperiplasmic space
- General Function
- Iron ion binding
- Specific Function
- Cytochrome c' is the most widely occurring bacterial c-type cytochrome. Cytochromes c' are high-spin proteins and the heme has no sixth ligand. Their exact function is not known.
- Pfam Domain Function
- Cytochrom_C_2 (PF01322)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00147 UniProtKB Entry Name CYCP_RHOCA - General References
- Ambler RP, Bartsch RG, Daniel M, Kamen MD, McLellan L, Meyer TE, Van Beeumen J: Amino acid sequences of bacterial cytochromes c' and c-556. Proc Natl Acad Sci U S A. 1981 Nov;78(11):6854-7. [Article]
- Tahirov TH, Misaki S, Meyer TE, Cusanovich MA, Higuchi Y, Yasuoka N: Concerted movement of side chains in the haem vicinity observed on ligand binding in cytochrome c' from rhodobacter capsulatus. Nat Struct Biol. 1996 May;3(5):459-64. [Article]
- Tahirov TH, Misaki S, Meyer TE, Cusanovich MA, Higuchi Y, Yasuoka N: High-resolution crystal structures of two polymorphs of cytochrome c' from the purple phototrophic bacterium rhodobacter capsulatus. J Mol Biol. 1996 Jun 14;259(3):467-79. [Article]
- Tahirov TH, Misaki S, Meyer TE, Cusanovich MA, Higuchi Y, Yasuoka N: Structure of cytochrome c' from Rhodobacter capsulatus strain St Louis: an unusual molecular association induced by bridging Zn ions. Acta Crystallogr D Biol Crystallogr. 1997 Nov 1;53(Pt 6):658-64. [Article]