Dihydrofolate reductase
Details
- Name
- Dihydrofolate reductase
- Synonyms
- 1.5.1.3
- Gene Name
- DHFR
- Organism
- Gallus gallus
- Amino acid sequence
>lcl|BSEQ0052482|Dihydrofolate reductase VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSI PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAV YKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFE VYQKSVLAQ
- Number of residues
- 189
- Molecular Weight
- 21649.77
- Theoretical pI
- Not Available
- GO Classification
- Functionsdihydrofolate reductase activity / drug binding / mRNA binding / NADP bindingProcessesdihydrofolate metabolic process / folic acid metabolic process / one-carbon metabolic process / response to methotrexate / tetrahydrofolate biosynthetic process / tetrahydrofolate metabolic processComponentsmitochondrion
- General Function
- Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis. May bind to mRNA.
- Specific Function
- Dihydrofolate reductase activity
- Pfam Domain Function
- DHFR_1 (PF00186)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00378 UniProtKB Entry Name DYR_CHICK - General References
- Kumar AA, Blankenship DT, Kaufman BT, Freisheim JH: Primary structure of chicken liver dihydrofolate reductase. Biochemistry. 1980 Feb 19;19(4):667-78. doi: 10.1021/bi00545a010. [Article]
- Fan YX, Ju M, Zhou JM, Tsou CL: Activation of chicken liver dihydrofolate reductase by urea and guanidine hydrochloride is accompanied by conformational change at the active site. Biochem J. 1996 Apr 1;315 ( Pt 1):97-102. doi: 10.1042/bj3150097. [Article]
- McTigue MA, Davies JF 2nd, Kaufman BT, Kraut J: Crystal structure of chicken liver dihydrofolate reductase complexed with NADP+ and biopterin. Biochemistry. 1992 Aug 18;31(32):7264-73. doi: 10.1021/bi00147a009. [Article]