Gastrin

Details

Name
Gastrin
Synonyms
  • GAS
Gene Name
GAST
Organism
Humans
Amino acid sequence
>lcl|BSEQ0051969|Gastrin
MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
Number of residues
101
Molecular Weight
11393.63
Theoretical pI
Not Available
GO Classification
Functions
hormone activity
Processes
G-protein coupled receptor signaling pathway / response to food / signal transduction
Components
extracellular region / extracellular space
General Function
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
Specific Function
Hormone activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0051970|Gastrin (GAST)
ATGCAGCGACTATGTGTGTATGTGCTGATCTTTGCACTGGCTCTGGCCGCCTTCTCTGAA
GCTTCTTGGAAGCCCCGCTCCCAGCAGCCAGATGCACCCTTAGGTACAGGGGCCAACAGG
GACCTGGAGCTACCCTGGCTGGAGCAGCAGGGCCCAGCCTCTCATCATCGAAGGCAGCTG
GGACCCCAGGGTCCCCCACACCTCGTGGCAGACCCGTCCAAGAAGCAGGGACCATGGCTG
GAGGAAGAAGAAGAAGCCTATGGATGGATGGACTTCGGCCGCCGCAGTGCTGAGGATGAG
AACTAA
Chromosome Location
17
Locus
17q21.2
External Identifiers
ResourceLink
UniProtKB IDP01350
UniProtKB Entry NameGAST_HUMAN
HGNC IDHGNC:4164
General References
  1. Kariya Y, Kato K, Hayashizaki Y, Himeno S, Tarui S, Matsubara K: Expression of human gastrin gene in normal and gastrinoma tissues. Gene. 1986;50(1-3):345-52. [Article]
  2. Ito R, Sato K, Helmer T, Jay G, Agarwal K: Structural analysis of the gene encoding human gastrin: the large intron contains an Alu sequence. Proc Natl Acad Sci U S A. 1984 Aug;81(15):4662-6. [Article]
  3. Kato K, Hayashizaki Y, Takahashi Y, Himeno S, Matsubara K: Molecular cloning of the human gastrin gene. Nucleic Acids Res. 1983 Dec 10;11(23):8197-203. [Article]
  4. Boel E, Vuust J, Norris F, Norris K, Wind A, Rehfeld JF, Marcker KA: Molecular cloning of human gastrin cDNA: evidence for evolution of gastrin by gene duplication. Proc Natl Acad Sci U S A. 1983 May;80(10):2866-9. [Article]
  5. Wiborg O, Berglund L, Boel E, Norris F, Norris K, Rehfeld JF, Marcker KA, Vuust J: Structure of a human gastrin gene. Proc Natl Acad Sci U S A. 1984 Feb;81(4):1067-9. [Article]
  6. Kato K, Himeno S, Takahashi Y, Wakabayashi T, Tarui S, Matsubara K: Molecular cloning of human gastrin precursor cDNA. Gene. 1983 Dec;26(1):53-7. [Article]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  8. Rehfeld JF, Johnsen AH: Identification of gastrin component I as gastrin-71. The largest possible bioactive progastrin product. Eur J Biochem. 1994 Aug 1;223(3):765-73. [Article]
  9. Bentley PH, Kenner GW, Sheppard RC: Structures of human gastrins I and II. Nature. 1966 Feb 5;209(5023):583-5. [Article]
  10. Higashimoto Y, Himeno S, Shinomura Y, Nagao K, Tamura T, Tarui S: Purification and structural determination of urinary NH2-terminal big gastrin fragments. Biochem Biophys Res Commun. 1989 May 15;160(3):1364-70. [Article]
  11. Gregory RA, Tracy HJ, Agarwal KL, Grossman MI: Aminoacid constitution of two gastrins isolated from Zollinger-Ellison tumour tissue. Gut. 1969 Aug;10(8):603-8. [Article]
  12. Varro A, Desmond H, Pauwels S, Gregory H, Young J, Dockray GJ: The human gastrin precursor. Characterization of phosphorylated forms and fragments. Biochem J. 1988 Dec 15;256(3):951-7. [Article]
  13. Rehfeld JF, Hansen CP, Johnsen AH: Post-poly(Glu) cleavage and degradation modified by O-sulfated tyrosine: a novel post-translational processing mechanism. EMBO J. 1995 Jan 16;14(2):389-96. [Article]
  14. Bundgaard JR, Vuust J, Rehfeld JF: Tyrosine O-sulfation promotes proteolytic processing of progastrin. EMBO J. 1995 Jul 3;14(13):3073-9. [Article]
  15. Palnaes Hansen C, Stadil F, Rehfeld JF: Metabolism and acid secretory effect of sulfated and nonsulfated gastrin-6 in humans. Am J Physiol Gastrointest Liver Physiol. 2000 Nov;279(5):G903-9. doi: 10.1152/ajpgi.2000.279.5.G903. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12532Oxetacaineapproved, investigationalyesinhibition of synthesisDetails