Insulin-like growth factor I

Details

Name
Insulin-like growth factor I
Synonyms
  • IBP1
  • IGF-I
  • Mechano growth factor
  • MGF
  • Somatomedin-C
Gene Name
IGF1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006670|Insulin-like growth factor I
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRR
EIGSRNAECRGKKGK
Number of residues
195
Molecular Weight
21841.02
Theoretical pI
10.32
GO Classification
Functions
hormone activity / insulin receptor binding / insulin-like growth factor receptor binding / integrin binding
Processes
blood coagulation / blood vessel remodeling / bone mineralization involved in bone maturation / branching morphogenesis of an epithelial tube / cell activation / cell proliferation / cellular protein metabolic process / chondroitin sulfate proteoglycan biosynthetic process / DNA replication / ERK1 and ERK2 cascade / exocrine pancreas development / extrinsic apoptotic signaling pathway in absence of ligand / glial cell differentiation / glycolate metabolic process / inner ear development / insulin-like growth factor receptor signaling pathway / lung alveolus development / lung lobe morphogenesis / lung vasculature development / mammary gland development / movement of cell or subcellular component / multicellular organism growth / muscle hypertrophy / muscle organ development / myoblast differentiation / myoblast proliferation / myotube cell development / negative regulation of androgen receptor signaling pathway / negative regulation of apoptotic process / negative regulation of cell proliferation / negative regulation of ERK1 and ERK2 cascade / negative regulation of extrinsic apoptotic signaling pathway / negative regulation of oocyte development / negative regulation of release of cytochrome c from mitochondria / negative regulation of smooth muscle cell apoptotic process / phosphatidylinositol 3-kinase signaling / phosphatidylinositol-mediated signaling / platelet activation / platelet degranulation / positive regulation of activated T cell proliferation / positive regulation of calcineurin-NFAT signaling cascade / positive regulation of cardiac muscle hypertrophy / positive regulation of cell migration / positive regulation of cell proliferation / positive regulation of cerebellar granule cell precursor proliferation / positive regulation of DNA binding / positive regulation of DNA replication / positive regulation of epithelial cell proliferation / positive regulation of fibroblast proliferation / positive regulation of glucose import / positive regulation of glycogen biosynthetic process / positive regulation of glycolytic process / positive regulation of glycoprotein biosynthetic process / positive regulation of insulin-like growth factor receptor signaling pathway / positive regulation of MAPK cascade / positive regulation of mitotic nuclear division / positive regulation of myoblast proliferation / positive regulation of osteoblast differentiation / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of phosphatidylinositol 3-kinase signaling / positive regulation of protein import into nucleus, translocation / positive regulation of protein kinase B signaling / positive regulation of protein secretion / positive regulation of Ras protein signal transduction / positive regulation of smooth muscle cell migration / positive regulation of smooth muscle cell proliferation / positive regulation of transcription from RNA polymerase II promoter / positive regulation of transcription regulatory region DNA binding / positive regulation of transcription, DNA-templated / positive regulation of trophectodermal cell proliferation / positive regulation of tyrosine phosphorylation of Stat5 protein / prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis / prostate gland growth / prostate gland stromal morphogenesis / protein kinase B signaling / protein stabilization / proteoglycan biosynthetic process / Ras protein signal transduction / regulation of establishment or maintenance of cell polarity / regulation of gene expression / regulation of multicellular organism growth / response to heat / signal transduction / skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration / skeletal system development / Type I pneumocyte differentiation / Type II pneumocyte differentiation / water homeostasis
Components
extracellular region / extracellular space / insulin-like growth factor binding protein complex / insulin-like growth factor ternary complex / plasma membrane / platelet alpha granule lumen
General Function
Integrin binding
Specific Function
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0017095|Insulin-like growth factor I (IGF1)
ATGGGAAAAATCAGCAGTCTTCCAACCCAATTATTTAAGTGCTGCTTTTGTGATTTCTTG
AAGGTGAAGATGCACACCATGTCCTCCTCGCATCTCTTCTACCTGGCGCTGTGCCTGCTC
ACCTTCACCAGCTCTGCCACGGCTGGACCGGAGACGCTCTGCGGGGCTGAGCTGGTGGAT
GCTCTTCAGTTCGTGTGTGGAGACAGGGGCTTTTATTTCAACAAGCCCACAGGGTATGGC
TCCAGCAGTCGGAGGGCGCCTCAGACAGGCATCGTGGATGAGTGCTGCTTCCGGAGCTGT
GATCTAAGGAGGCTGGAGATGTATTGCGCACCCCTCAAGCCTGCCAAGTCAGCTCGCTCT
GTCCGTGCCCAGCGCCACACCGACATGCCCAAGACCCAGAAGGAAGTACATTTGAAGAAC
GCAAGTAGAGGGAGTGCAGGAAACAAGAACTACAGGATGTAG
Chromosome Location
12
Locus
12q22-q23
External Identifiers
ResourceLink
UniProtKB IDP05019
UniProtKB Entry NameIGF1_HUMAN
GenBank Gene IDM14155
GenAtlas IDIGF1
HGNC IDHGNC:5464
General References
  1. Jansen M, van Schaik FM, Ricker AT, Bullock B, Woods DE, Gabbay KH, Nussbaum AL, Sussenbach JS, Van den Brande JL: Sequence of cDNA encoding human insulin-like growth factor I precursor. Nature. 1983 Dec 8-14;306(5943):609-11. [Article]
  2. de Pagter-Holthuizen P, van Schaik FM, Verduijn GM, van Ommen GJ, Bouma BN, Jansen M, Sussenbach JS: Organization of the human genes for insulin-like growth factors I and II. FEBS Lett. 1986 Jan 20;195(1-2):179-84. [Article]
  3. Le Bouc Y, Dreyer D, Jaeger F, Binoux M, Sondermeyer P: Complete characterization of the human IGF-I nucleotide sequence isolated from a newly constructed adult liver cDNA library. FEBS Lett. 1986 Feb 3;196(1):108-12. [Article]
  4. Rotwein P, Pollock KM, Didier DK, Krivi GG: Organization and sequence of the human insulin-like growth factor I gene. Alternative RNA processing produces two insulin-like growth factor I precursor peptides. J Biol Chem. 1986 Apr 15;261(11):4828-32. [Article]
  5. Rotwein P: Two insulin-like growth factor I messenger RNAs are expressed in human liver. Proc Natl Acad Sci U S A. 1986 Jan;83(1):77-81. [Article]
  6. Tobin G, Yee D, Brunner N, Rotwein P: A novel human insulin-like growth factor I messenger RNA is expressed in normal and tumor cells. Mol Endocrinol. 1990 Dec;4(12):1914-20. [Article]
  7. Steenbergh PH, Koonen-Reemst AM, Cleutjens CB, Sussenbach JS: Complete nucleotide sequence of the high molecular weight human IGF-I mRNA. Biochem Biophys Res Commun. 1991 Mar 15;175(2):507-14. [Article]
  8. Sandberg-Nordqvist AC, Stahlbom PA, Lake M, Sara VR: Characterization of two cDNAs encoding insulin-like growth factor 1 (IGF-1) in the human fetal brain. Brain Res Mol Brain Res. 1992 Jan;12(1-3):275-7. [Article]
  9. Sandberg-Nordqvist AC, Stahlbom PA, Reinecke M, Collins VP, von Holst H, Sara V: Characterization of insulin-like growth factor 1 in human primary brain tumors. Cancer Res. 1993 Jun 1;53(11):2475-8. [Article]
  10. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [Article]
  11. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  12. Dull TJ, Gray A, Hayflick JS, Ullrich A: Insulin-like growth factor II precursor gene organization in relation to insulin gene family. Nature. 1984 Aug 30-Sep 5;310(5980):777-81. [Article]
  13. Rinderknecht E, Humbel RE: The amino acid sequence of human insulin-like growth factor I and its structural homology with proinsulin. J Biol Chem. 1978 Apr 25;253(8):2769-76. [Article]
  14. Raschdorf F, Dahinden R, Maerki W, Richter WJ, Merryweather JP: Location of disulphide bonds in human insulin-like growth factors (IGFs) synthesized by recombinant DNA technology. Biomed Environ Mass Spectrom. 1988 Oct;16(1-12):3-8. [Article]
  15. Zoidis E, Ghirlanda-Keller C, Schmid C: Stimulation of glucose transport in osteoblastic cells by parathyroid hormone and insulin-like growth factor I. Mol Cell Biochem. 2011 Feb;348(1-2):33-42. doi: 10.1007/s11010-010-0634-z. Epub 2010 Nov 13. [Article]
  16. Shcheglovitov A, Shcheglovitova O, Yazawa M, Portmann T, Shu R, Sebastiano V, Krawisz A, Froehlich W, Bernstein JA, Hallmayer JF, Dolmetsch RE: SHANK3 and IGF1 restore synaptic deficits in neurons from 22q13 deletion syndrome patients. Nature. 2013 Nov 14;503(7475):267-71. doi: 10.1038/nature12618. Epub 2013 Oct 16. [Article]
  17. Blundell TL, Bedarkar S, Humbel RE: Tertiary structures, receptor binding, and antigenicity of insulinlike growth factors. Fed Proc. 1983 Jun;42(9):2592-7. [Article]
  18. Cooke RM, Harvey TS, Campbell ID: Solution structure of human insulin-like growth factor 1: a nuclear magnetic resonance and restrained molecular dynamics study. Biochemistry. 1991 Jun 4;30(22):5484-91. [Article]
  19. Sato A, Nishimura S, Ohkubo T, Kyogoku Y, Koyama S, Kobayashi M, Yasuda T, Kobayashi Y: 1H-NMR assignment and secondary structure of human insulin-like growth factor-I (IGF-I) in solution. J Biochem. 1992 Apr;111(4):529-36. [Article]
  20. Woods KA, Camacho-Hubner C, Savage MO, Clark AJ: Intrauterine growth retardation and postnatal growth failure associated with deletion of the insulin-like growth factor I gene. N Engl J Med. 1996 Oct 31;335(18):1363-7. [Article]
  21. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01890N,N-Bis(3-(D-gluconamido)propyl)deoxycholamideexperimentalunknownDetails
DB02643N-Dodecyl-N,N-Dimethyl-3-Ammonio-1-PropanesulfonateexperimentalunknownDetails