Interleukin-5
Details
- Name
- Interleukin-5
- Synonyms
- B-cell differentiation factor I
- Eosinophil differentiation factor
- IL-5
- T-cell replacing factor
- TRF
- Gene Name
- IL5
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0016349|Interleukin-5 MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ EFLGVMNTEWIIES
- Number of residues
- 134
- Molecular Weight
- 15237.695
- Theoretical pI
- 8.23
- GO Classification
- Functionscytokine activity / interleukin-5 receptor bindingProcessesactivation of MAPKK activity / axon guidance / cytokine-mediated signaling pathway / epidermal growth factor receptor signaling pathway / Fc-epsilon receptor signaling pathway / fibroblast growth factor receptor signaling pathway / inflammatory response / innate immune response / insulin receptor signaling pathway / MAPK cascade / neurotrophin TRK receptor signaling pathway / positive regulation of B cell proliferation / positive regulation of eosinophil differentiation / positive regulation of immunoglobulin secretion / positive regulation of JAK-STAT cascade / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of podosome assembly / positive regulation of sequence-specific DNA binding transcription factor activity / Ras protein signal transduction / small GTPase mediated signal transduction / vascular endothelial growth factor receptor signaling pathwayComponentsextracellular region / extracellular space / intracellular
- General Function
- Interleukin-5 receptor binding
- Specific Function
- Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
- Pfam Domain Function
- IL5 (PF02025)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0016350|Interleukin-5 (IL5) ATGAGGATGCTTCTGCATTTGAGTTTGCTAGCTCTTGGAGCTGCCTACGTGTATGCCATC CCCACAGAAATTCCCACAAGTGCATTGGTGAAAGAGACCTTGGCACTGCTTTCTACTCAT CGAACTCTGCTGATAGCCAATGAGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCAC CAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAGTCAAACTGTGCAA GGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGC CAAAAAAAAAAGTGTGGAGAAGAAAGACGGAGAGTAAACCAATTCCTAGACTACCTGCAA GAGTTTCTTGGTGTAATGAACACCGAGTGGATAATAGAAAGTTGA
- Chromosome Location
- 5
- Locus
- 5q31.1
- External Identifiers
Resource Link UniProtKB ID P05113 UniProtKB Entry Name IL5_HUMAN GenBank Protein ID 33836 GenBank Gene ID X04688 GenAtlas ID IL5 HGNC ID HGNC:6016 - General References
- Azuma C, Tanabe T, Konishi M, Kinashi T, Noma T, Matsuda F, Yaoita Y, Takatsu K, Hammarstrom L, Smith CI, et al.: Cloning of cDNA for human T-cell replacing factor (interleukin-5) and comparison with the murine homologue. Nucleic Acids Res. 1986 Nov 25;14(22):9149-58. [Article]
- Tanabe T, Konishi M, Mizuta T, Noma T, Honjo T: Molecular cloning and structure of the human interleukin-5 gene. J Biol Chem. 1987 Dec 5;262(34):16580-4. [Article]
- Campbell HD, Tucker WQ, Hort Y, Martinson ME, Mayo G, Clutterbuck EJ, Sanderson CJ, Young IG: Molecular cloning, nucleotide sequence, and expression of the gene encoding human eosinophil differentiation factor (interleukin 5). Proc Natl Acad Sci U S A. 1987 Oct;84(19):6629-33. [Article]
- Yokota T, Coffman RL, Hagiwara H, Rennick DM, Takebe Y, Yokota K, Gemmell L, Shrader B, Yang G, Meyerson P, et al.: Isolation and characterization of lymphokine cDNA clones encoding mouse and human IgA-enhancing factor and eosinophil colony-stimulating factor activities: relationship to interleukin 5. Proc Natl Acad Sci U S A. 1987 Nov;84(21):7388-92. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Minamitake Y, Kodama S, Katayama T, Adachi H, Tanaka S, Tsujimoto M: Structure of recombinant human interleukin 5 produced by Chinese hamster ovary cells. J Biochem. 1990 Feb;107(2):292-7. [Article]
- Proudfoot AE, Davies JG, Turcatti G, Wingfield PT: Human interleukin-5 expressed in Escherichia coli: assignment of the disulfide bridges of the purified unglycosylated protein. FEBS Lett. 1991 May 20;283(1):61-4. [Article]
- Milburn MV, Hassell AM, Lambert MH, Jordan SR, Proudfoot AE, Graber P, Wells TN: A novel dimer configuration revealed by the crystal structure at 2.4 A resolution of human interleukin-5. Nature. 1993 May 13;363(6425):172-6. [Article]
- Patino E, Kotzsch A, Saremba S, Nickel J, Schmitz W, Sebald W, Mueller TD: Structure analysis of the IL-5 ligand-receptor complex reveals a wrench-like architecture for IL-5Ralpha. Structure. 2011 Dec 7;19(12):1864-75. doi: 10.1016/j.str.2011.08.015. [Article]