Interleukin-5

Details

Name
Interleukin-5
Synonyms
  • B-cell differentiation factor I
  • Eosinophil differentiation factor
  • IL-5
  • T-cell replacing factor
  • TRF
Gene Name
IL5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016349|Interleukin-5
MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES
Number of residues
134
Molecular Weight
15237.695
Theoretical pI
8.23
GO Classification
Functions
cytokine activity / interleukin-5 receptor binding
Processes
activation of MAPKK activity / axon guidance / cytokine-mediated signaling pathway / epidermal growth factor receptor signaling pathway / Fc-epsilon receptor signaling pathway / fibroblast growth factor receptor signaling pathway / inflammatory response / innate immune response / insulin receptor signaling pathway / MAPK cascade / neurotrophin TRK receptor signaling pathway / positive regulation of B cell proliferation / positive regulation of eosinophil differentiation / positive regulation of immunoglobulin secretion / positive regulation of JAK-STAT cascade / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of podosome assembly / positive regulation of sequence-specific DNA binding transcription factor activity / Ras protein signal transduction / small GTPase mediated signal transduction / vascular endothelial growth factor receptor signaling pathway
Components
extracellular region / extracellular space / intracellular
General Function
Interleukin-5 receptor binding
Specific Function
Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0016350|Interleukin-5 (IL5)
ATGAGGATGCTTCTGCATTTGAGTTTGCTAGCTCTTGGAGCTGCCTACGTGTATGCCATC
CCCACAGAAATTCCCACAAGTGCATTGGTGAAAGAGACCTTGGCACTGCTTTCTACTCAT
CGAACTCTGCTGATAGCCAATGAGACTCTGAGGATTCCTGTTCCTGTACATAAAAATCAC
CAACTGTGCACTGAAGAAATCTTTCAGGGAATAGGCACACTGGAGAGTCAAACTGTGCAA
GGGGGTACTGTGGAAAGACTATTCAAAAACTTGTCCTTAATAAAGAAATACATTGACGGC
CAAAAAAAAAAGTGTGGAGAAGAAAGACGGAGAGTAAACCAATTCCTAGACTACCTGCAA
GAGTTTCTTGGTGTAATGAACACCGAGTGGATAATAGAAAGTTGA
Chromosome Location
5
Locus
5q31.1
External Identifiers
ResourceLink
UniProtKB IDP05113
UniProtKB Entry NameIL5_HUMAN
GenBank Protein ID33836
GenBank Gene IDX04688
GenAtlas IDIL5
HGNC IDHGNC:6016
General References
  1. Azuma C, Tanabe T, Konishi M, Kinashi T, Noma T, Matsuda F, Yaoita Y, Takatsu K, Hammarstrom L, Smith CI, et al.: Cloning of cDNA for human T-cell replacing factor (interleukin-5) and comparison with the murine homologue. Nucleic Acids Res. 1986 Nov 25;14(22):9149-58. [Article]
  2. Tanabe T, Konishi M, Mizuta T, Noma T, Honjo T: Molecular cloning and structure of the human interleukin-5 gene. J Biol Chem. 1987 Dec 5;262(34):16580-4. [Article]
  3. Campbell HD, Tucker WQ, Hort Y, Martinson ME, Mayo G, Clutterbuck EJ, Sanderson CJ, Young IG: Molecular cloning, nucleotide sequence, and expression of the gene encoding human eosinophil differentiation factor (interleukin 5). Proc Natl Acad Sci U S A. 1987 Oct;84(19):6629-33. [Article]
  4. Yokota T, Coffman RL, Hagiwara H, Rennick DM, Takebe Y, Yokota K, Gemmell L, Shrader B, Yang G, Meyerson P, et al.: Isolation and characterization of lymphokine cDNA clones encoding mouse and human IgA-enhancing factor and eosinophil colony-stimulating factor activities: relationship to interleukin 5. Proc Natl Acad Sci U S A. 1987 Nov;84(21):7388-92. [Article]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  6. Minamitake Y, Kodama S, Katayama T, Adachi H, Tanaka S, Tsujimoto M: Structure of recombinant human interleukin 5 produced by Chinese hamster ovary cells. J Biochem. 1990 Feb;107(2):292-7. [Article]
  7. Proudfoot AE, Davies JG, Turcatti G, Wingfield PT: Human interleukin-5 expressed in Escherichia coli: assignment of the disulfide bridges of the purified unglycosylated protein. FEBS Lett. 1991 May 20;283(1):61-4. [Article]
  8. Milburn MV, Hassell AM, Lambert MH, Jordan SR, Proudfoot AE, Graber P, Wells TN: A novel dimer configuration revealed by the crystal structure at 2.4 A resolution of human interleukin-5. Nature. 1993 May 13;363(6425):172-6. [Article]
  9. Patino E, Kotzsch A, Saremba S, Nickel J, Schmitz W, Sebald W, Mueller TD: Structure analysis of the IL-5 ligand-receptor complex reveals a wrench-like architecture for IL-5Ralpha. Structure. 2011 Dec 7;19(12):1864-75. doi: 10.1016/j.str.2011.08.015. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01411PranlukastinvestigationalunknownantagonistDetails
DB06612Mepolizumabapproved, investigationalyesantagonistDetails
DB06602Reslizumabapproved, investigationalyesantagonistDetails