Cytochrome P450 2C6
Details
- Name
- Cytochrome P450 2C6
- Synonyms
- 1.14.14.1
- Cyp2c-6
- CYPIIC6
- Cytochrome P450 PB1
- PTF2
- Gene Name
- Cyp2c6
- Organism
- Rat
- Amino acid sequence
>lcl|BSEQ0051629|Cytochrome P450 2C6 MDLVMLLVLTLTCLILLSIWRQSSGRGKLPPGPIPLPIIGNIFQLNVKNITQSLTSFSKV YGPVFTLYFGTKPTVILHGYEAVKEALIDHGEEFAERGSFPVAEKINKDLGIVFSHGNRW KEIRRFTLTTLRNLGMGKRNIEDRVQEEARCLVEELRKTNGSPCDPTFILGCAPCNVICS IIFQNRFDYKDQDFLNLMEKLNENMKILSSPWTQFCSFFPVLIDYCPGSHTTLAKNVYHI RNYLLKKIKEHQESLDVTNPRDFIDYYLIKWKQENHNPHSEFTLENLSITVTDLFGAGTE TTSTTLRYALLLLLKCPEVTAKVQEEIDRVVGKHRSPCMQDRSRMPYTDAHDHEVQRFID LIPTNLPHAVTCDIKFRNYLIPKGTTIITSLSSVLHDSKEFPDPEIFDPGHFLDGNGKFK KSDYFMPFSAGKRMCAGEGLARMELFLFLTTILQNFKLKSVLHPKDIDTTPVFNGFASLP PFYELCFIPL
- Number of residues
- 490
- Molecular Weight
- 56002.315
- Theoretical pI
- Not Available
- GO Classification
- Functionsarachidonic acid epoxygenase activity / aromatase activity / enzyme binding / heme binding / iron ion binding / monooxygenase activity / oxidoreductase activity / steroid hydroxylase activityProcessesdrug metabolic process / epoxygenase P450 pathway / exogenous drug catabolic process / heterocycle metabolic process / monoterpenoid metabolic process / oxidation-reduction process / response to drug / steroid metabolic processComponentsendoplasmic reticulum membrane / organelle membrane
- General Function
- Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
- Specific Function
- Arachidonic acid epoxygenase activity
- Pfam Domain Function
- p450 (PF00067)
- Transmembrane Regions
- Not Available
- Cellular Location
- Endoplasmic reticulum membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P05178 UniProtKB Entry Name CP2C6_RAT - General References
- Kimura H, Yoshioka H, Sogawa K, Sakai Y, Fujii-Kuriyama Y: Complementary DNA cloning of cytochrome P-450s related to P-450(M-1) from the complementary DNA library of female rat livers. Predicted primary structures for P-450f, PB-1, and PB-1-related protein with a bizarre replacement block and their mode of transcriptional expression. J Biol Chem. 1988 Jan 15;263(2):701-7. [Article]
- Gonzalez FJ, Kimura S, Song BJ, Pastewka J, Gelboin HV, Hardwick JP: Sequence of two related P-450 mRNAs transcriptionally increased during rat development. An R.dre.1 sequence occupies the complete 3' untranslated region of a liver mRNA. J Biol Chem. 1986 Aug 15;261(23):10667-72. [Article]
- Friedberg T, Waxman DJ, Atchison M, Kumar A, Haaparanta T, Raphael C, Adesnik M: Isolation and characterization of cDNA clones for cytochromes P-450 immunochemically related to rat hepatic P-450 form PB-1. Biochemistry. 1986 Dec 2;25(24):7975-83. [Article]
- Umeno M, Morris S, Matsunaga E, Gelboin HV, Gonzalez FJ: Sequence of the 5' end of the developmentally regulated rat P450 PB1 (P450IIC6) gene. Nucleic Acids Res. 1988 Jul 11;16(13):6249. [Article]