Bifunctional ligase/repressor BirA
Details
- Name
- Bifunctional ligase/repressor BirA
- Synonyms
- bioR
- Biotin operon repressor
- Biotin--[acetyl-CoA-carboxylase] ligase
- Biotin--protein ligase
- Biotin-[acetyl-CoA carboxylase] synthetase
- dhbB
- Gene Name
- birA
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0012339|Bifunctional ligase/repressor BirA MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSL PEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRGRRG RKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWPNDLYLQ DRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAA MLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLL EQDGIIKPWMGGEISLRSAEK
- Number of residues
- 321
- Molecular Weight
- 35311.67
- Theoretical pI
- 8.4
- GO Classification
- FunctionsATP binding / biotin-[acetyl-CoA-carboxylase] ligase activity / DNA bindingProcessesbiotin biosynthetic process / protein biotinylation / regulation of transcription, DNA-templated / transcription, DNA-templated
- General Function
- Dna binding
- Specific Function
- Acts both as a biotin--[acetyl-CoA-carboxylase] ligase and a biotin-operon repressor. In the presence of ATP, BirA activates biotin to form the BirA-biotinyl-5'-adenylate (BirA-bio-5'-AMP or holoBirA) complex. HoloBirA can either transfer the biotinyl moiety to the biotin carboxyl carrier protein (BCCP) subunit of acetyl-CoA carboxylase, or bind to the biotin operator site and inhibit transcription of the operon.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0012340|Bifunctional ligase/repressor BirA (birA) ATGAAGGATAACACCGTGCCACTGAAATTGATTGCCCTGTTAGCGAACGGTGAATTTCAC TCTGGCGAGCAGTTGGGTGAAACGCTGGGAATGAGCCGGGCGGCTATTAATAAACACATT CAGACACTGCGTGACTGGGGCGTTGATGTCTTTACCGTTCCGGGTAAAGGATACAGCCTG CCTGAGCCTATCCAGTTACTTAATGCTAAACAGATATTGGGTCAGCTGGATGGCGGTAGT GTAGCCGTGCTGCCAGTGATTGACTCCACGAATCAGTACCTTCTTGATCGTATCGGAGAG CTTAAATCGGGCGATGCTTGCATTGCAGAATACCAGCAGGCTGGCCGTGGTCGCCGGGGT CGGAAATGGTTTTCGCCTTTTGGCGCAAACTTATATTTGTCGATGTTCTGGCGTCTGGAA CAAGGCCCGGCGGCGGCGATTGGTTTAAGTCTGGTTATCGGTATCGTGATGGCGGAAGTA TTACGCAAGCTGGGTGCAGATAAAGTTCGTGTTAAATGGCCTAATGACCTCTATCTGCAG GATCGCAAGCTGGCAGGCATTCTGGTGGAGCTGACTGGCAAAACTGGCGATGCGGCGCAA ATAGTCATTGGAGCCGGGATCAACATGGCAATGCGCCGTGTTGAAGAGAGTGTCGTTAAT CAGGGGTGGATCACGCTGCAGGAAGCGGGGATCAATCTCGATCGTAATACGTTGGCGGCC ATGCTAATACGTGAATTACGTGCTGCGTTGGAACTCTTCGAACAAGAAGGATTGGCACCT TATCTGTCGCGCTGGGAAAAGCTGGATAATTTTATTAATCGCCCAGTGAAACTTATCATT GGTGATAAAGAAATATTTGGCATTTCACGCGGAATAGACAAACAGGGGGCTTTATTACTT GAGCAGGATGGAATAATAAAACCCTGGATGGGCGGTGAAATATCCCTGCGTAGTGCAGAA AAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P06709 UniProtKB Entry Name BIRA_ECOLI GenBank Gene ID M10123 - General References
- Howard PK, Shaw J, Otsuka AJ: Nucleotide sequence of the birA gene encoding the biotin operon repressor and biotin holoenzyme synthetase functions of Escherichia coli. Gene. 1985;35(3):321-31. [Article]
- Buoncristiani MR, Howard PK, Otsuka AJ: DNA-binding and enzymatic domains of the bifunctional biotin operon repressor (BirA) of Escherichia coli. Gene. 1986;44(2-3):255-61. [Article]
- Blattner FR, Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL: Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes. Nucleic Acids Res. 1993 Nov 25;21(23):5408-17. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Pucci MJ, Discotto LF, Dougherty TJ: Cloning and identification of the Escherichia coli murB DNA sequence, which encodes UDP-N-acetylenolpyruvoylglucosamine reductase. J Bacteriol. 1992 Mar;174(5):1690-3. [Article]
- Song WJ, Jackowski S: Cloning, sequencing, and expression of the pantothenate kinase (coaA) gene of Escherichia coli. J Bacteriol. 1992 Oct;174(20):6411-7. [Article]
- Eisenberg MA, Prakash O, Hsiung SC: Purification and properties of the biotin repressor. A bifunctional protein. J Biol Chem. 1982 Dec 25;257(24):15167-73. [Article]
- Cronan JE Jr: The E. coli bio operon: transcriptional repression by an essential protein modification enzyme. Cell. 1989 Aug 11;58(3):427-9. [Article]
- Xu Y, Beckett D: Kinetics of biotinyl-5'-adenylate synthesis catalyzed by the Escherichia coli repressor of biotin biosynthesis and the stability of the enzyme-product complex. Biochemistry. 1994 Jun 14;33(23):7354-60. [Article]
- Streaker ED, Beckett D: Coupling of protein assembly and DNA binding: biotin repressor dimerization precedes biotin operator binding. J Mol Biol. 2003 Jan 31;325(5):937-48. [Article]
- Chakravartty V, Cronan JE: The wing of a winged helix-turn-helix transcription factor organizes the active site of BirA, a bifunctional repressor/ligase. J Biol Chem. 2013 Dec 13;288(50):36029-39. doi: 10.1074/jbc.M113.525618. Epub 2013 Nov 4. [Article]
- Adikaram PR, Beckett D: Protein:protein interactions in control of a transcriptional switch. J Mol Biol. 2013 Nov 15;425(22):4584-94. doi: 10.1016/j.jmb.2013.07.029. Epub 2013 Jul 26. [Article]
- Wilson KP, Shewchuk LM, Brennan RG, Otsuka AJ, Matthews BW: Escherichia coli biotin holoenzyme synthetase/bio repressor crystal structure delineates the biotin- and DNA-binding domains. Proc Natl Acad Sci U S A. 1992 Oct 1;89(19):9257-61. [Article]
- Weaver LH, Kwon K, Beckett D, Matthews BW: Corepressor-induced organization and assembly of the biotin repressor: a model for allosteric activation of a transcriptional regulator. Proc Natl Acad Sci U S A. 2001 May 22;98(11):6045-50. Epub 2001 May 15. [Article]
- Wood ZA, Weaver LH, Brown PH, Beckett D, Matthews BW: Co-repressor induced order and biotin repressor dimerization: a case for divergent followed by convergent evolution. J Mol Biol. 2006 Mar 24;357(2):509-23. Epub 2006 Jan 6. [Article]