Penicillin G acylase
Details
- Name
- Penicillin G acylase
- Synonyms
- 3.5.1.11
- Penicillin G amidase
- Penicillin G amidohydrolase
- Gene Name
- pac
- Organism
- Escherichia coli
- Amino acid sequence
>lcl|BSEQ0012652|Penicillin G acylase MKNRNRMIVNCVTASLMYYWSLPALAEQSSSEIKIVRDEYGMPHIYANDTWHLFYGYGYV VAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSILQ GYADGMNAWIDKVNTNPETLLPKQFNTFGFTPKRWEPFDVAMIFVGTMANRFSDSTSEID NLALLTALKDKYGVSQGMAVFNQLKWLVNPSAPTTIAVQESNYPLKFNQQNSQTAALLPR YDLPAPMLDRPAKGADGALLALTAGKNRETIAAQFAQGGANGLAGYPTTSNMWVIGKSKA QDAKAIMVNGPQFGWYAPAYTYGIGLHGAGYDVTGNTPFAYPGLVFGHNGVISWGSTAGF GDDVDIFAERLSAEKPGYYLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNILQTDQ TTQTAYAKSRAWDGKEVASLLAWTHQMKAKNWQEWTQQAAKQALTINWYYADVNGNIGYV HTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMNPKVYNPQSGYIANWNNSPQKDYPAS DLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLT QSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWY SASGYETTQDGPTGSLNISVGAKILYEAVQGDKSPIPQAVDLFAGKPQQEVVLAALEDTW ETLSKRYGNNVSNWKTPAMALTFRANNFFGVPQAAAEETRHQAEYQNRGTENDMIVFSPT TSDRPVLAWDVVAPGQSGFIAPDGTVDKHYEDQLKMYENFGRKSLWLTKQDVEAHKESQE VLHVQR
- Number of residues
- 846
- Molecular Weight
- 94642.025
- Theoretical pI
- 6.59
- GO Classification
- Functionsmetal ion binding / penicillin amidase activityProcessesantibiotic biosynthetic process / response to antibioticComponentsperiplasmic space
- General Function
- Penicillin amidase activity
- Specific Function
- Not Available
- Pfam Domain Function
- Penicil_amidase (PF01804)
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P06875 UniProtKB Entry Name PAC_ECOLX GenBank Protein ID 147063 GenBank Gene ID M15950 - General References
- Schumacher G, Sizmann D, Haug H, Buckel P, Bock A: Penicillin acylase from E. coli: unique gene-protein relation. Nucleic Acids Res. 1986 Jul 25;14(14):5713-27. [Article]
- Oh SJ, Kim YC, Park YW, Min SY, Kim IS, Kang HS: Complete nucleotide sequence of the penicillin G acylase gene and the flanking regions, and its expression in Escherichia coli. Gene. 1987;56(1):87-97. [Article]
- Oliver G, Valle F, Rosetti F, Gomez-Pedrozo M, Santamaria P, Gosset G, Bolivar F: A common precursor for the two subunits of the penicillin acylase from Escherichia coli ATCC11105. Gene. 1985;40(1):9-14. [Article]
- Valle F, Gosset G, Tenorio B, Oliver G, Bolivar F: Characterization of the regulatory region of the Escherichia coli penicillin acylase structural gene. Gene. 1986;50(1-3):119-22. [Article]
- Bruns W, Hoppe J, Tsai H, Bruning HJ, Maywald F, Collins J, Mayer H: Structure of the penicillin acylase gene from Escherichia coli: a periplasmic enzyme that undergoes multiple proteolytic processing. J Mol Appl Genet. 1985;3(1):36-44. [Article]
- Slade A, Horrocks AJ, Lindsay CD, Dunbar B, Virden R: Site-directed chemical conversion of serine to cysteine in penicillin acylase from Escherichia coli ATCC 11105. Effect on conformation and catalytic activity. Eur J Biochem. 1991 Apr 10;197(1):75-80. [Article]
- Sizmann D, Keilmann C, Bock A: Primary structure requirements for the maturation in vivo of penicillin acylase from Escherichia coli ATCC 11105. Eur J Biochem. 1990 Aug 28;192(1):143-51. [Article]
- Duggleby HJ, Tolley SP, Hill CP, Dodson EJ, Dodson G, Moody PC: Penicillin acylase has a single-amino-acid catalytic centre. Nature. 1995 Jan 19;373(6511):264-8. [Article]
- McVey CE, Walsh MA, Dodson GG, Wilson KS, Brannigan JA: Crystal structures of penicillin acylase enzyme-substrate complexes: structural insights into the catalytic mechanism. J Mol Biol. 2001 Oct 12;313(1):139-50. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB07331 p-Nitrophenylacetic acid experimental unknown Details DB01702 2-(3,4-Dihydroxyphenyl)Acetic Acid experimental unknown Details DB08193 2-(3-NITROPHENYL)ACETIC ACID experimental unknown Details DB08327 Homogentisic acid experimental unknown Details DB08559 N-[(2S,4S,6R)-2-(dihydroxymethyl)-4-hydroxy-3,3-dimethyl-7-oxo-4lambda~4~-thia-1-azabicyclo[3.2.0]hept-6-yl]-2-phenylacetamide experimental unknown Details