Regulatory protein SdiA
Details
- Name
- Regulatory protein SdiA
- Synonyms
- Not Available
- Gene Name
- sdiA
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0017334|Regulatory protein SdiA MQDKDFFSWRRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFY TNYPEAWVSYYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVT QYLMLPNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNF SKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI
- Number of residues
- 240
- Molecular Weight
- 28117.125
- Theoretical pI
- 7.04
- GO Classification
- FunctionsDNA bindingProcessescell cycle / cell division / positive regulation of cytokinesis / positive regulation of DNA-templated transcription, initiation / transcription, DNA-templated
- General Function
- Dna binding
- Specific Function
- Activates cell division by specifically increasing transcription from one of the two promoters that lie immediately upstream of the ftsQAZ gene cluster. Activates ydiV expression in response to extracellular autoinducer AI-1 (Vibrio fischeri autoinducer oxoC6).
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
>lcl|BSEQ0017335|Regulatory protein SdiA (sdiA) ATGCAGGATAAGGATTTTTTCAGCTGGCGTCGCACGATGCTGTTGCGTTTTCAGAGGATG GAGACCGCAGAAGAGGTCTACCATGAAATTGAGCTTCAGGCTCAGCAGCTGGAGTACGAT TACTATTCGTTATGTGTCCGCCACCCGGTACCATTCACTCGACCTAAAGTGGCTTTTTAC ACCAATTACCCTGAGGCGTGGGTTAGTTATTATCAGGCAAAAAACTTTCTCGCAATTGAT CCGGTGCTGAACCCTGAAAACTTTAGTCAGGGCCATTTAATGTGGAATGATGACTTATTC AGCGAAGCACAGCCGTTATGGGAAGCCGCGCGCGCACATGGTTTACGCCGCGGTGTCACT CAGTATTTAATGCTGCCAAACCGGGCGCTGGGCTTTTTGTCCTTTTCCCGTTGCAGCGCG CGCGAAATACCCATTCTTAGTGATGAACTGCAATTAAAAATGCAGTTACTGGTGCGCGAA AGTCTGATGGCTCTGATGCGTTTAAATGATGAAATAGTGATGACGCCAGAGATGAATTTC AGCAAGCGCGAAAAAGAAATTCTGAGGTGGACGGCGGAAGGGAAAACATCAGCAGAGATA GCGATGATTTTGTCAATCTCTGAGAATACGGTCAATTTCCACCAGAAAAACATGCAGAAA AAAATTAATGCACCAAATAAGACCCAGGTTGCCTGTTACGCGGCCGCTACTGGCTTAATT TGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P07026 UniProtKB Entry Name SDIA_ECOLI GenBank Protein ID 43288 GenBank Gene ID X03691 - General References
- Sharma S, Stark TF, Beattie WG, Moses RE: Multiple control elements for the uvrC gene unit of Escherichia coli. Nucleic Acids Res. 1986 Mar 11;14(5):2301-18. [Article]
- Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al.: A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):379-92. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Wang XD, de Boer PA, Rothfield LI: A factor that positively regulates cell division by activating transcription of the major cluster of essential cell division genes of Escherichia coli. EMBO J. 1991 Nov;10(11):3363-72. [Article]
- Zhou X, Meng X, Sun B: An EAL domain protein and cyclic AMP contribute to the interaction between the two quorum sensing systems in Escherichia coli. Cell Res. 2008 Sep;18(9):937-48. doi: 10.1038/cr.2008.67. [Article]
- Yao Y, Martinez-Yamout MA, Dickerson TJ, Brogan AP, Wright PE, Dyson HJ: Structure of the Escherichia coli quorum sensing protein SdiA: activation of the folding switch by acyl homoserine lactones. J Mol Biol. 2006 Jan 13;355(2):262-73. Epub 2005 Nov 8. [Article]