Ribonuclease pancreatic

Details

Name
Ribonuclease pancreatic
Synonyms
  • 4.6.1.18
  • HP-RNase
  • RIB-1
  • RIB1
  • Ribonuclease 1
  • Ribonuclease A
  • RNase 1
  • RNase A
  • RNase UpI-1
  • RNS1
Gene Name
RNASE1
UniProtKB Entry
P07998Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0012319|Ribonuclease pancreatic
MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
Number of residues
156
Molecular Weight
17644.125
Theoretical pI
8.94
GO Classification
Functions
lyase activity / RNA nuclease activity
Processes
defense response to Gram-positive bacterium
General Function
Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single-stranded and double-stranded RNA
Specific Function
Lyase activity
Pfam Domain Function
Signal Regions
1-28
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0012320|Ribonuclease pancreatic (RNASE1)
ATGGCTCTGGAGAAGTCTCTTGTCCGGCTCCTTCTGCTTGTCCTGATACTGCTGGTGCTG
GGCTGGGTCCAGCCTTCCCTGGGCAAGGAATCCCGGGCCAAGAAATTCCAGCGGCAGCAT
ATGGACTCAGACAGTTCCCCCAGCAGCAGCTCCACCTACTGTAACCAAATGATGAGGCGC
CGGAATATGACACAGGGGCGGTGCAAACCAGTGAACACCTTTGTGCACGAGCCCCTGGTA
GATGTCCAGAATGTCTGTTTCCAGGAAAAGGTCACCTGCAAGAACGGGCAGGGCAACTGC
TACAAGAGCAACTCCAGCATGCACATCACAGACTGCCGCCTGACAAACGGCTCCAGGTAC
CCCAACTGTGCATACCGGACCAGCCCGAAGGAGAGACACATCATTGTGGCCTGTGAAGGG
AGCCCATATGTGCCAGTCCACTTTGATGCTTCTGTGGAGGACTCTACCTAA
Chromosome Location
14
Locus
14q11.2
External Identifiers
ResourceLink
UniProtKB IDP07998
UniProtKB Entry NameRNAS1_HUMAN
GenBank Gene IDD26129
GeneCard IDRNASE1
GenAtlas IDRNASE1
HGNC IDHGNC:10044
PDB ID(s)1DZA, 1E21, 1H8X, 1Z7X, 2E0J, 2E0L, 2E0M, 2E0O, 2K11, 2Q4G, 3F8G, 4KXH
KEGG IDhsa:6035
NCBI Gene ID6035
General References
  1. Seno M, Futami J, Kosaka M, Seno S, Yamada H: Nucleotide sequence encoding human pancreatic ribonuclease. Biochim Biophys Acta. 1994 Aug 2;1218(3):466-8. [Article]
  2. Schienman JE, Holt RA, Auerbach MR, Stewart CB: Duplication and divergence of 2 distinct pancreatic ribonuclease genes in leaf-eating African and Asian colobine monkeys. Mol Biol Evol. 2006 Aug;23(8):1465-79. Epub 2006 Jun 2. [Article]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Kochetov AV, Lukasheva VV, Filipenko ML, Mertvetsov NP, Rivkin MI: [Primary structure of the coding part of the gene for human pancreatic ribonuclease and its chromosomal location]. Bioorg Khim. 1995 Sep;21(9):691-4. [Article]
  6. Russo N, de Nigris M, Ciardiello A, Di Donato A, D'Alessio G: Expression in mammalian cells, purification and characterization of recombinant human pancreatic ribonuclease. FEBS Lett. 1995 Aug 7;369(2-3):352. [Article]
  7. Haugg M, Schein CH: The DNA sequences of the human and hamster secretory ribonucleases determined with the polymerase chain reaction (PCR). Nucleic Acids Res. 1992 Feb 11;20(3):612. [Article]
  8. Beintema JJ, Wietzes P, Weickmann JL, Glitz DG: The amino acid sequence of human pancreatic ribonuclease. Anal Biochem. 1984 Jan;136(1):48-64. [Article]
  9. Beintema JJ, Blank A, Schieven GL, Dekker CA, Sorrentino S, Libonati M: Differences in glycosylation pattern of human secretory ribonucleases. Biochem J. 1988 Oct 15;255(2):501-5. [Article]
  10. Mizuta K, Awazu S, Yasuda T, Kishi K: Purification and characterization of three ribonucleases from human kidney: comparison with urine ribonucleases. Arch Biochem Biophys. 1990 Aug 15;281(1):144-51. [Article]
  11. Sakakibara R, Hashida K, Tominaga N, Sakai K, Ishiguro M, Imamura S, Ohmatsu F, Sato E: A putative mouse oocyte maturation inhibitory protein from urine of pregnant women: N-terminal sequence homology with human nonsecretory ribonuclease. Chem Pharm Bull (Tokyo). 1991 Jan;39(1):146-9. [Article]
  12. Sakakibara R, Hashida K, Kitahara T, Ishiguro M: Characterization of a unique nonsecretory ribonuclease from urine of pregnant women. J Biochem. 1992 Mar;111(3):325-30. [Article]
  13. Yasuda T, Nadano D, Takeshita H, Kishi K: Two distinct secretory ribonucleases from human cerebrum: purification, characterization and relationships to other ribonucleases. Biochem J. 1993 Dec 15;296 ( Pt 3):617-25. [Article]
  14. Pous J, Canals A, Terzyan SS, Guasch A, Benito A, Ribo M, Vilanova M, Coll M: Three-dimensional structure of a human pancreatic ribonuclease variant, a step forward in the design of cytotoxic ribonucleases. J Mol Biol. 2000 Oct 13;303(1):49-60. [Article]
  15. Pous J, Mallorqui-Fernandez G, Peracaula R, Terzyan SS, Futami J, Tada H, Yamada H, Seno M, de Llorens R, Gomis-Ruth FX, Coll M: Three-dimensional structure of human RNase 1 delta N7 at 1.9 A resolution. Acta Crystallogr D Biol Crystallogr. 2001 Apr;57(Pt 4):498-505. [Article]
  16. Canals A, Pous J, Guasch A, Benito A, Ribo M, Vilanova M, Coll M: The structure of an engineered domain-swapped ribonuclease dimer and its implications for the evolution of proteins toward oligomerization. Structure. 2001 Oct;9(10):967-76. [Article]
  17. Johnson RJ, McCoy JG, Bingman CA, Phillips GN Jr, Raines RT: Inhibition of human pancreatic ribonuclease by the human ribonuclease inhibitor protein. J Mol Biol. 2007 Apr 27;368(2):434-49. Epub 2007 Feb 9. [Article]
  18. Yamada H, Tamada T, Kosaka M, Miyata K, Fujiki S, Tano M, Moriya M, Yamanishi M, Honjo E, Tada H, Ino T, Yamaguchi H, Futami J, Seno M, Nomoto T, Hirata T, Yoshimura M, Kuroki R: 'Crystal lattice engineering,' an approach to engineer protein crystal contacts by creating intermolecular symmetry: crystallization and structure determination of a mutant human RNase 1 with a hydrophobic interface of leucines. Protein Sci. 2007 Jul;16(7):1389-97. [Article]

Associated Data

Bio-Entities
Bio-EntityType
Ribonuclease pancreatic (Humans)protein
primary
Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
Adenosine 3',5'-diphosphateexperimentalunknowntargetDetails
3'-Phosphate-Adenosine-5'-DiphosphateexperimentalunknowntargetDetails
Formic acidexperimental, investigationalunknowntargetDetails
Cytidine 3'-monophosphateexperimentalunknowntargetDetails
Adenosine-2'-5'-DiphosphateexperimentalunknowntargetDetails
2'-Monophosphoadenosine-5'-DiphosphateexperimentalunknowntargetDetails
Arabinouridine 3'-phosphateexperimentalunknowntargetDetails
GuanidineapprovedunknowntargetDetails
2'-fluoro-2'-deoxyuridine 3'-monophosphateexperimentalunknowntargetDetails
Adenylate-3'-phosphate-[[2'-deoxy-uridine-5'-phosphate]-3'-phosphate]experimentalunknowntargetDetails
Deoxycytidylyl-3',5'-guanosineexperimentalunknowntargetDetails
2'-Deoxyuridine 3'-MonophosphateexperimentalunknowntargetDetails
Uridine-2',3'-vanadateexperimentalunknowntargetDetails
Purine Riboside-5'-MonophosphateexperimentalunknowntargetDetails
2'-cytidylic acidexperimentalunknowntargetDetails
5-AminouracilexperimentalunknowntargetDetails
tert-butanolexperimentalunknowntargetDetails
Citric acidapproved, nutraceutical, vet_approvedunknowntargetDetails
2'-deoxycytidine-2'-deoxyadenosine-3',5'-monophosphateexperimentalunknowntargetDetails
3'-UridinemonophosphateexperimentalunknowntargetDetails
Cysteine-S-acetamideexperimentalunknowntargetDetails
Uridylyl-2'-5'-phospho-adenosineexperimentalunknowntargetDetails
Uridylyl-2'-5'-phospho-guanosineexperimentalunknowntargetDetails
Aspartic acidapproved, nutraceuticalunknowntargetDetails
N-FormylmethionineexperimentalunknowntargetDetails
5'-deoxy-5'-piperidin-1-ylthymidineexperimentalunknowntargetDetails
1-(2,5-dideoxy-5-pyrrolidin-1-yl-beta-L-erythro-pentofuranosyl)-5-methylpyrimidine-2,4(1H,3H)-dioneexperimentalunknowntargetDetails