Insulin-like growth factor-binding protein 1
Details
- Name
- Insulin-like growth factor-binding protein 1
- Synonyms
- IBP-1
- IBP1
- Placental protein 12
- PP12
- Gene Name
- IGFBP1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0052008|Insulin-like growth factor-binding protein 1 MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP GSPEIRGDPNCQIYFNVQN
- Number of residues
- 259
- Molecular Weight
- 27903.38
- Theoretical pI
- Not Available
- GO Classification
- Functionsinsulin-like growth factor binding / insulin-like growth factor I binding / insulin-like growth factor II binding / signaling receptor bindingProcessesaging / cellular protein metabolic process / insulin receptor signaling pathway / negative regulation of canonical Wnt signaling pathway / PERK-mediated unfolded protein response / positive regulation of cell growth / post-translational protein modification / regulation of insulin-like growth factor receptor signaling pathway / signal transduction / tissue regenerationComponentsendoplasmic reticulum lumen / extracellular region / extracellular space / Golgi apparatus
- General Function
- IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.
- Specific Function
- Insulin-like growth factor binding
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0052009|Insulin-like growth factor-binding protein 1 (IGFBP1) ATGTCAGAGGTCCCCGTTGCTCGCGTCTGGCTGGTACTGCTCCTGCTGACTGTCCAGGTC GGCGTGACAGCCGGCGCTCCGTGGCAGTGCGCGCCCTGCTCCGCCGAGAAGCTCGCGCTC TGCCCGCCGGTGTCCGCCTCGTGCTCGGAGGTCACCCGGTCCGCCGGCTGCGGCTGTTGC CCGATGTGCGCCCTGCCTCTGGGCGCCGCGTGCGGCGTGGCGACTGCACGCTGCGCCCGG GGACTCAGTTGCCGCGCGCTGCCGGGGGAGCAGCAACCTCTGCACGCCCTCACCCGCGGC CAAGGCGCCTGCGTGCAGGAGTCTGACGCCTCCGCTCCCCATGCTGCAGAGGCAGGGAGC CCTGAAAGCCCAGAGAGCACGGAGATAACTGAGGAGGAGCTCCTGGATAATTTCCATCTG ATGGCCCCTTCTGAAGAGGATCATTCCATCCTTTGGGACGCCATCAGTACCTATGATGGC TCGAAGGCTCTCCATGTCACCAACATCAAAAAATGGAAGGAGCCCTGCCGAATAGAACTC TACAGAGTCGTAGAGAGTTTAGCCAAGGCACAGGAGACATCAGGAGAAGAAATTTCCAAA TTTTACCTGCCAAACTGCAACAAGAATGGATTTTATCACAGCAGACAGTGTGAGACATCC ATGGATGGAGAGGCGGGACTCTGCTGGTGCGTCTACCCTTGGAATGGGAAGAGGATCCCT GGGTCTCCAGAGATCAGGGGAGACCCCAACTGCCAGATATATTTTAATGTACAAAACTGA
- Chromosome Location
- 7
- Locus
- 7p12.3
- External Identifiers
Resource Link UniProtKB ID P08833 UniProtKB Entry Name IBP1_HUMAN HGNC ID HGNC:5469 - General References
- Brinkman A, Groffen C, Kortleve DJ, Geurts van Kessel A, Drop SL: Isolation and characterization of a cDNA encoding the low molecular weight insulin-like growth factor binding protein (IBP-1). EMBO J. 1988 Aug;7(8):2417-23. [Article]
- Brewer MT, Stetler GL, Squires CH, Thompson RC, Busby WH, Clemmons DR: Cloning, characterization, and expression of a human insulin-like growth factor binding protein. Biochem Biophys Res Commun. 1988 May 16;152(3):1289-97. [Article]
- Grundmann U, Nerlich C, Bohn H, Rein T: Cloning of cDNA encoding human placental protein 12 (PP12): binding protein for IGF I and somatomedin. Nucleic Acids Res. 1988 Sep 12;16(17):8711. [Article]
- Julkunen M, Koistinen R, Aalto-Setala K, Seppala M, Janne OA, Kontula K: Primary structure of human insulin-like growth factor-binding protein/placental protein 12 and tissue-specific expression of its mRNA. FEBS Lett. 1988 Aug 29;236(2):295-302. [Article]
- Lee YL, Hintz RL, James PM, Lee PD, Shively JE, Powell DR: Insulin-like growth factor (IGF) binding protein complementary deoxyribonucleic acid from human HEP G2 hepatoma cells: predicted protein sequence suggests an IGF binding domain different from those of the IGF-I and IGF-II receptors. Mol Endocrinol. 1988 May;2(5):404-11. [Article]
- Cubbage ML, Suwanichkul A, Powell DR: Structure of the human chromosomal gene for the 25 kilodalton insulin-like growth factor binding protein. Mol Endocrinol. 1989 May;3(5):846-51. [Article]
- Brinkman A, Groffen CA, Kortleve DJ, Drop SL: Organization of the gene encoding the insulin-like growth factor binding protein IBP-1. Biochem Biophys Res Commun. 1988 Dec 30;157(3):898-907. [Article]
- Ehrenborg E, Larsson C, Stern I, Janson M, Powell DR, Luthman H: Contiguous localization of the genes encoding human insulin-like growth factor binding proteins 1 (IGBP1) and 3 (IGBP3) on chromosome 7. Genomics. 1992 Mar;12(3):497-502. [Article]
- Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Dolcini L, Sala A, Campagnoli M, Labo S, Valli M, Visai L, Minchiotti L, Monaco HL, Galliano M: Identification of the amniotic fluid insulin-like growth factor binding protein-1 phosphorylation sites and propensity to proteolysis of the isoforms. FEBS J. 2009 Oct;276(20):6033-46. doi: 10.1111/j.1742-4658.2009.07318.x. Epub 2009 Sep 17. [Article]
- Luthman H, Soderling-Barros J, Persson B, Engberg C, Stern I, Lake M, Franzen SA, Israelsson M, Raden B, Lindgren B, et al.: Human insulin-like growth-factor-binding protein. Low-molecular-mass form: protein sequence and cDNA cloning. Eur J Biochem. 1989 Mar 15;180(2):259-65. [Article]
- Busby WH Jr, Klapper DG, Clemmons DR: Purification of a 31,000-dalton insulin-like growth factor binding protein from human amniotic fluid. Isolation of two forms with different biologic actions. J Biol Chem. 1988 Oct 5;263(28):14203-10. [Article]
- Brinkman A, Kortleve DJ, Schuller AG, Zwarthoff EC, Drop SL: Site-directed mutagenesis of the N-terminal region of IGF binding protein 1; analysis of IGF binding capability. FEBS Lett. 1991 Oct 21;291(2):264-8. [Article]
- Jones JI, Busby WH Jr, Wright G, Smith CE, Kimack NM, Clemmons DR: Identification of the sites of phosphorylation in insulin-like growth factor binding protein-1. Regulation of its affinity by phosphorylation of serine 101. J Biol Chem. 1993 Jan 15;268(2):1125-31. [Article]
- Neumann GM, Bach LA: The N-terminal disulfide linkages of human insulin-like growth factor-binding protein-6 (hIGFBP-6) and hIGFBP-1 are different as determined by mass spectrometry. J Biol Chem. 1999 May 21;274(21):14587-94. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028. [Article]
- Sala A, Capaldi S, Campagnoli M, Faggion B, Labo S, Perduca M, Romano A, Carrizo ME, Valli M, Visai L, Minchiotti L, Galliano M, Monaco HL: Structure and properties of the C-terminal domain of insulin-like growth factor-binding protein-1 isolated from human amniotic fluid. J Biol Chem. 2005 Aug 19;280(33):29812-9. Epub 2005 Jun 22. [Article]
- Sitar T, Popowicz GM, Siwanowicz I, Huber R, Holak TA: Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Proc Natl Acad Sci U S A. 2006 Aug 29;103(35):13028-33. Epub 2006 Aug 21. [Article]