Thymidine kinase

Details

Name
Thymidine kinase
Synonyms
  • 2.7.1.21
Gene Name
TK
Organism
HHV-3
Amino acid sequence
>lcl|BSEQ0017455|Thymidine kinase
MSTDKTDVKMGVLRIYLDGAYGIGKTTAAEEFLHHFAITPNRILLIGEPLSYWRNLAGED
AICGIYGTQTRRLNGDVSPEDAQRLTAHFQSLFCSPHAIMHAKISALMDTSTSDLVQVNK
EPYKIMLSDRHPIASTICFPLSRYLVGDMSPAALPGLLFTLPAEPPGTNLVVCTVSLPSH
LSRVSKRARPGETVNLPFVMVLRNVYIMLINTIIFLKTNNWHAGWNTLSFCNDVFKQKLQ
KSECIKLREVPGIEDTLFAVLKLPELCGEFGNILPLWAWGMETLSNCSRSMSPFVLSLEQ
TPQHAAQELKTLLPQMTPANMSSGAWNILKELVNAVQDNTS
Number of residues
341
Molecular Weight
37816.49
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / thymidine kinase activity
Processes
DNA biosynthetic process / TMP biosynthetic process
General Function
Catalyzes the transfer of the gamma-phospho group of ATP to thymidine to generate dTMP in the salvage pathway of pyrimidine synthesis. The dTMP serves as a substrate for DNA polymerase during viral DNA replication. Allows the virus to be reactivated and to grow in non-proliferative cells lacking a high concentration of phosphorylated nucleic acid precursors.
Specific Function
Atp binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP09250
UniProtKB Entry NameKITH_VZVD
General References
  1. Davison AJ, Scott JE: The complete DNA sequence of varicella-zoster virus. J Gen Virol. 1986 Sep;67 ( Pt 9):1759-816. [Article]
  2. Sawyer MH, Inchauspe G, Biron KK, Waters DJ, Straus SE, Ostrove JM: Molecular analysis of the pyrimidine deoxyribonucleoside kinase gene of wild-type and acyclovir-resistant strains of varicella-zoster virus. J Gen Virol. 1988 Oct;69 ( Pt 10):2585-93. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00194Vidarabineapproved, investigationalyesinducerDetails