SPARC

Details

Name
SPARC
Synonyms
  • Basement-membrane protein 40
  • BM-40
  • ON
  • Osteonectin
  • Secreted protein acidic and rich in cysteine
Gene Name
SPARC
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004208|SPARC
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD
LVI
Number of residues
303
Molecular Weight
34631.88
Theoretical pI
4.47
GO Classification
Functions
calcium ion binding / collagen binding / extracellular matrix binding
Processes
blood coagulation / bone development / cellular response to growth factor stimulus / extracellular matrix organization / heart development / inner ear development / lung development / negative regulation of angiogenesis / negative regulation of endothelial cell proliferation / ossification / platelet activation / platelet degranulation / positive regulation of endothelial cell migration / receptor-mediated endocytosis / regulation of cell morphogenesis / response to cadmium ion / response to calcium ion / response to cAMP / response to cytokine / response to ethanol / response to glucocorticoid / response to gravity / response to L-ascorbic acid / response to lead ion / response to lipopolysaccharide / response to peptide hormone / signal transduction
Components
basement membrane / cell surface / cytoplasm / endocytic vesicle lumen / extracellular region / extracellular space / nuclear matrix / platelet alpha granule / platelet alpha granule lumen / platelet alpha granule membrane
General Function
Extracellular matrix binding
Specific Function
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0011555|SPARC (SPARC)
ATGAGGGCCTGGATCTTCTTTCTCCTTTGCCTGGCCGGGAGGGCCTTGGCAGCCCCTCAA
GAAGCCCTGCCTGATGAGACAGAGGTGGTGGAAGAAACTGTGGCAGAGGTGACTGAGGTA
TCTGTGGGAGCTAATCCTGTCCAGGTGGAAGTAGGAGAATTTGATGATGGTGCAGAGGAA
ACCGAAGAGGAGGTGGTGGCGGAAAATCCCTGCCAGAACCACCACTGCAAACACGGCAAG
GTGTGCGAGCTGGATGAGAACAACACCCCCATGTGCGTGTGCCAGGACCCCACCAGCTGC
CCAGCCCCCATTGGCGAGTTTGAGAAGGTGTGCAGCAATGACAACAAGACCTTCGACTCT
TCCTGCCACTTCTTTGCCACAAAGTGCACCCTGGAGGGCACCAAGAAGGGCCACAAGCTC
CACCTGGACTACATCGGGCCTTGCAAATACATCCCCCCTTGCCTGGACTCTGAGCTGACC
GAATTCCCCCTGCGCATGCGGGACTGGCTCAAGAACGTCCTGGTCACCCTGTATGAGAGG
GATGAGGACAACAACCTTCTGACTGAGAAGCAGAAGCTGCGGGTGAAGAAGATCCATGAG
AATGAGAAGCGCCTGGAGGCAGGAGACCACCCCGTGGAGCTGCTGGCCCGGGACTTCGAG
AAGAACTATAACATGTACATCTTCCCTGTACACTGGCAGTTCGGCCAGCTGGACCAGCAC
CCCATTGACGGGTACCTCTCCCACACCGAGCTGGCTCCACTGCGTGCTCCCCTCATCCCC
ATGGAGCATTGCACCACCCGCTTTTTCGAGACCTGTGACCTGGACAATGACAAGTACATC
GCCCTGGATGAGTGGGCCGGCTGCTTCGGCATCAAGCAGAAGGATATCGACAAGGATCTT
GTGATCTAA
Chromosome Location
5
Locus
5q31.3-q32
External Identifiers
ResourceLink
UniProtKB IDP09486
UniProtKB Entry NameSPRC_HUMAN
GenBank Protein ID29462
GenBank Gene IDY00755
GenAtlas IDSPARC
HGNC IDHGNC:11219
General References
  1. Lankat-Buttgereit B, Mann K, Deutzmann R, Timpl R, Krieg T: Cloning and complete amino acid sequences of human and murine basement membrane protein BM-40 (SPARC, osteonectin). FEBS Lett. 1988 Aug 29;236(2):352-6. [Article]
  2. Swaroop A, Hogan BL, Francke U: Molecular analysis of the cDNA for human SPARC/osteonectin/BM-40: sequence, expression, and localization of the gene to chromosome 5q31-q33. Genomics. 1988 Jan;2(1):37-47. [Article]
  3. Villarreal XC, Mann KG, Long GL: Structure of human osteonectin based upon analysis of cDNA and genomic sequences. Biochemistry. 1989 Jul 25;28(15):6483-91. [Article]
  4. Young MF, Day AA, Dominquez P, McQuillan CI, Fisher LW, Termine JD: Structure and expression of osteonectin mRNA in human tissue. Connect Tissue Res. 1990;24(1):17-28. [Article]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [Article]
  7. Fisher LW, Hawkins GR, Tuross N, Termine JD: Purification and partial characterization of small proteoglycans I and II, bone sialoproteins I and II, and osteonectin from the mineral compartment of developing human bone. J Biol Chem. 1987 Jul 15;262(20):9702-8. [Article]
  8. Kelm RJ Jr, Mann KG: Human platelet osteonectin: release, surface expression, and partial characterization. Blood. 1990 Mar 1;75(5):1105-13. [Article]
  9. Wewer UM, Albrechtsen R, Fisher LW, Young MF, Termine JD: Osteonectin/SPARC/BM-40 in human decidua and carcinoma, tissues characterized by de novo formation of basement membrane. Am J Pathol. 1988 Aug;132(2):345-55. [Article]
  10. Kuhn C, Mason RJ: Immunolocalization of SPARC, tenascin, and thrombospondin in pulmonary fibrosis. Am J Pathol. 1995 Dec;147(6):1759-69. [Article]
  11. Hunzelmann N, Hafner M, Anders S, Krieg T, Nischt R: BM-40 (osteonectin, SPARC) is expressed both in the epidermal and in the dermal compartment of adult human skin. J Invest Dermatol. 1998 Feb;110(2):122-6. [Article]
  12. Hohenester E, Maurer P, Hohenadl C, Timpl R, Jansonius JN, Engel J: Structure of a novel extracellular Ca(2+)-binding module in BM-40. Nat Struct Biol. 1996 Jan;3(1):67-73. [Article]
  13. Hohenester E, Maurer P, Timpl R: Crystal structure of a pair of follistatin-like and EF-hand calcium-binding domains in BM-40. EMBO J. 1997 Jul 1;16(13):3778-86. [Article]
  14. Sasaki T, Hohenester E, Gohring W, Timpl R: Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin. EMBO J. 1998 Mar 16;17(6):1625-34. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11093Calcium citrateapproved, investigationalnoligandDetails
DB11348Calcium PhosphateapprovednoligandDetails
DB14481Calcium phosphate dihydrateapprovednoDetails